Glyma02g41400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g41400

Feature Type:	gene_model
Chromosome:	Gm02
Start:	46540809
stop:	46543675
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g41400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G37820	AT	Annotation by Michelle Graham. TAIR10: NOD26-like intrinsic protein 4;2 \| chr5:15050261-15051542 FORWARD LENGTH=283	SoyBase	E_val: 1.00E-112	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0015250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: water channel activity	SoyBase	N/A	ISS
KOG0223	KOG	Aquaporin (major intrinsic protein family)	JGI		ISS
PTHR19139	Panther	AQUAPORIN TRANSPORTER	JGI		ISS
PTHR19139:SF22	Panther	gb def: glycerol uptake facilitator protein [mycoplasma pulmonis]	JGI		ISS
PF00230	PFAM	Major intrinsic protein	JGI		ISS
UniRef100_B9GV36	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin, MIP family, NIP subfamily n=1 Tax=Populus trichocarpa RepID=B9GV36_POPTR	SoyBase	E_val: 2.00E-135	ISS
UniRef100_I1JHX7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JHX7_SOYBN	SoyBase	E_val: 3.00E-150	ISS

Expression Patterns of Glyma02g41400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g41400

Paralog	Evidence	Comments
Glyma14g07560	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g41400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g246700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g41400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g41400

Limit To All Plant Sequences

>Glyma02g41400.2   sequence type=CDS   gene model=Glyma02g41400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCCAAATCTGAAGGCATCCAAGAAGAAGAAATGTCAAGTATGGAAGAGGGTGTTTCTTCCCCCAGCTCTTCCAGAACATGTTCCATGTCACATAACTGTTGTTCTAACGTTGTAACCCTCGCGCAGAAGGTGATGGCAGAAGTTATTGGCACATATTTTGTGGTATTTGCGGGTTGTGGCTCTGTGGCAGTGAATAAGATCTATGGCTCAGTCACATTTCCAGGGGTTTGTGTCACATGGGGACTGATTGTAATGGTCATGATTTACTCTCTTCGTCGTATCTCTGGAGCTCACTTCAATCCTGCAGTCACCATTACTTTAGCCATCTTTCGCCGGTTCTCATATAAAGAGGTGCCACTCTACATTTTTGCTCAGTTGCTGGGGTCGATCCTTGCTAGTGGCACATTAGCCCTAATGTTGGATGTAACGCCTAAAGCTTACTTTGGAACGGTACCAGTTGGATCCAATGGCCAGTCTTTAGTTGCTGAAATCATTATCACTTTTCTCTTGATGTTTGTTATATCTGCCGTTTCTACAGATGACAGAGCGGTGGGTGACTTTGCAGGTGTTGCAGTTGGGATGACTATAATGTTGAATGTCTTCATTGCCGGGCCAGTATCAGGAGCTTCCATGAACCCTGCAAGAAGTATTGGTCCCGCACTTATCAAACATGTTTACAAAGGGTTATGGGTATACGTAGTTGGTCCCGTTGTTGGATCCATTGCTGGAGCACTTGCCTATTATTTTCTTAGATCCATAGACAAGTCATCTTCAGAATAA

Predicted protein sequences of Glyma02g41400

Limit To All Plant Sequences

>Glyma02g41400.2   sequence type=predicted peptide   gene model=Glyma02g41400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAKSEGIQEEEMSSMEEGVSSPSSSRTCSMSHNCCSNVVTLAQKVMAEVIGTYFVVFAGCGSVAVNKIYGSVTFPGVCVTWGLIVMVMIYSLRRISGAHFNPAVTITLAIFRRFSYKEVPLYIFAQLLGSILASGTLALMLDVTPKAYFGTVPVGSNGQSLVAEIIITFLLMFVISAVSTDDRAVGDFAGVAVGMTIMLNVFIAGPVSGASMNPARSIGPALIKHVYKGLWVYVVGPVVGSIAGALAYYFLRSIDKSSSE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain