SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g41170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g41170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g41170

Feature Type:gene_model
Chromosome:Gm02
Start:46331759
stop:46335001
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g41170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G37680AT Annotation by Michelle Graham. TAIR10: ADP-ribosylation factor-like A1A | chr5:14969797-14971098 REVERSE LENGTH=184 SoyBaseE_val: 6.00E-127ISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009691GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0075 KOG GTP-binding ADP-ribosylation factor-like protein JGI ISS
PTHR11711Panther ARF-RELATED JGI ISS
PTHR11711:SF20Panther ADP-RIBOSYLATION FACTOR-RELATED JGI ISS
PF00025PFAM ADP-ribosylation factor family JGI ISS
UniRef100_C6SVP4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVP4_SOYBN SoyBaseE_val: 2.00E-131ISS
UniRef100_G7K1N4UniRef Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor-like protein n=1 Tax=Medicago truncatula RepID=G7K1N4_MEDTR SoyBaseE_val: 9.00E-126ISS

Expression Patterns of Glyma02g41170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g41170 not represented in the dataset
Glyma02g41170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g41170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g244500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g41170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g41170
>Glyma02g41170.1   sequence type=CDS   gene model=Glyma02g41170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCTCTGGGATTCCTTCCTCAATTGGCTCCGCAGCTTGTTTTTTAAACAGGAGATGGAACTTTCACTTGTTGGCCTTCAGAATGCTGGCAAGACTTCTCTTGTCAATGCAATTGCTACTGGGGGCTACAGTGAGGACATGATTCCAACTGTTGGTTTCAACATGAGAAAAGTGACTAAGGGAAATGTCACAATAAAGCTTTGGGACCTTGGGGGACAGAGGAGGTTCCGATCAATGTGGGAGCGATACTGTCGGGGTGTCTCTGCTATCGTATATGTTGTAGATGCCGCTGATAGAGACAGTGTTCCAATATCTCGAAGTGAGTTACATGATCTATTGACAAAACCTTCTTTGAGTGCGATTCCTTTGCTTGTTCTTGGAAACAAAATTGACAAGTCAGAAGCTCTTTCTAAGCAAGCATTGGTAGATCAGCTAGGACTTGAGTCAATTAAAGACAGAGAGGTCTGCTGCTATATGATTTCATGCAAGGATTCTGTTAACATAGATGTAGTCATTGACTGGCTAATCAAACACTCAAAAACTGCAAAGTGA
Predicted protein sequences of Glyma02g41170
>Glyma02g41170.1   sequence type=predicted peptide   gene model=Glyma02g41170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLWDSFLNWLRSLFFKQEMELSLVGLQNAGKTSLVNAIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQRRFRSMWERYCRGVSAIVYVVDAADRDSVPISRSELHDLLTKPSLSAIPLLVLGNKIDKSEALSKQALVDQLGLESIKDREVCCYMISCKDSVNIDVVIDWLIKHSKTAK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo