SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g40920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g40920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g40920

Feature Type:gene_model
Chromosome:Gm02
Start:46121767
stop:46123094
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G66080AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF775 (InterPro:IPR008493); Has 285 Blast hits to 283 proteins in 133 species: Archae - 0; Bacteria - 0; Metazoa - 120; Fungi - 88; Plants - 50; Viruses - 0; Other Eukaryotes - 27 (source: NCBI BLink). | chr1:24600356-24601027 REVERSE LENGTH=190 SoyBaseE_val: 5.00E-114ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4067 KOG Uncharacterized conserved protein JGI ISS
PTHR12925Panther UNCHARACTERIZED JGI ISS
PF05603PFAM Protein of unknown function (DUF775) JGI ISS
UniRef100_G7KFW9UniRef Annotation by Michelle Graham. Most informative UniRef hit: OPI10-like protein n=1 Tax=Medicago truncatula RepID=G7KFW9_MEDTR SoyBaseE_val: 3.00E-118ISS
UniRef100_I1JHT7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JHT7_SOYBN SoyBaseE_val: 1.00E-135ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g40920 not represented in the dataset

Glyma02g40920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g39250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g242000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g40920.1   sequence type=CDS   gene model=Glyma02g40920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCGGAGTAGTTTTCCCGAACCGGAGCTTCCCCATGGACATCTCAACCTTCGCTCAAATCGACACCTTCCACTGGGTCCTCGACATGAACACTTTCGTAGGCGAGGCTTTCGACCAGGTCCGGGAGCTCTGCATCTTCCTCCTCAACGGCTACACGCTGCCGCCGGAGAAGGCGCTCGCCGTCTACATCCAGTCGCCGGGGTCGCCGTTCGTGTTCTGCGGCGCCGTCACGGTGGCGCGGCCCTCCGCCGTGCTGACGCTGGCGTGGCCAGAGCCCGGCGCCGGAGGGCCGATGCAGCTGACGGCGGACGCGCAGCCGCTGTCGGCGAAGATCGGGGTGTCGGTGGAGGATCTGGCGTCGCTGCCGTCGCTCGACGTGGCGGCGGAGAAGCGAATCGAGGGTTTGGCGATGAAGGTCGGAGAGAATCTGTTCAATTTCATGCAATCGTTTTGCGGCGTGGACGGGTCGAAGCTGATTGTTCCGATGGATATCTTGGACCGGTGGTTCAAGAAGTTTCAGGAGCGGGCCAGGCGTGACCCTGAATACTTGAAGGGTTTCGCTTCGTAA

>Glyma02g40920.1   sequence type=predicted peptide   gene model=Glyma02g40920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFGVVFPNRSFPMDISTFAQIDTFHWVLDMNTFVGEAFDQVRELCIFLLNGYTLPPEKALAVYIQSPGSPFVFCGAVTVARPSAVLTLAWPEPGAGGPMQLTADAQPLSAKIGVSVEDLASLPSLDVAAEKRIEGLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQERARRDPEYLKGFAS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo