SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g40460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g40460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g40460

Feature Type:gene_model
Chromosome:Gm02
Start:45690634
stop:45692011
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g40460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G08600AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1191) | chr3:2612646-2613596 FORWARD LENGTH=316 SoyBaseE_val: 7.00E-69ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06697PFAM Protein of unknown function (DUF1191) JGI ISS
UniRef100_I1JHN8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JHN8_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q2QYI6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa RepID=Q2QYI6_ORYSJ SoyBaseE_val: 6.00E-84ISS

Expression Patterns of Glyma02g40460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g40460 not represented in the dataset
Glyma02g40460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g40460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g237900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g40460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g40460
>Glyma02g40460.1   sequence type=CDS   gene model=Glyma02g40460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGTCAGAGCCAGTTTCTTTGTGCTGTTCTCATTGTCATGCCTTCTTTGTGTGTTACTTTCAAGTGCTCAACAACTTCCACCTGATGCTGTTGTTTCGGCTCGTTTGTTAGATTCCCATCTTCAAGATTCGGCCTTTAGGGCCCTTTTCAGTCCAATAACCGGTGTGCCCTATGATGCTCAAGTGCCCACCAACCTTTCAGGGATCAAAGTTTCAGCAATGAGGCTTAGGAGTGGTAGTTTGAGGACAAGGGGTGTTCTTAGCTACAAAGAATTTGAGATCCCAATTGGGGTTGTTGAGAAGCCCTATGTGGAGAGGCTTGTGTTGGTGTACCAAAACTTAGGTAATTGGTCTGATCAATTTTACCCTTTACCTGGTTTTTCATATTTGGCTCCTGTTTTGGGCCTCTTGGCCTATAGTGGAATTAATTTGTCAGCCTCAGAGTTACCTGAGTTGGATATAAGGGCTTCTGAGAAGCCAGTTTTGGTCAATTTTCCTCATGTGAGGCCAGCACCATTGGGGGCATTGGCCAAATGTGTGTATTTTGATTTGCATGGTTCTGTGCAATTTGACACTCTATTACCTGGGAATGTGTGTTCAACAATGCAACAAGGGCACTTCTCTATAGTTGTGGAATCCAATGCACCATCACCAGCGCCTAGTAGTGGTGGGGAATTTCAAGATGCTAGTGGGAAGAACAATAAGAAAAATAACAAGTTCATGTTGAGGATATTGGCTCCATGTGTGGTTGGTGGAATTGTGTTGTTGATTATTATTTTGGGTCTATTGGTTGTTTTAGTGAGAAGACACACGAAAGGGACAAGGATGCAGCAATTGGAATGTGTAGCTTATAGCAATGAAATCATGGATATGACATCCATTGGTGACATCAAAGTACCATTAGCATTTGGGACTCGTACAAGACCAATGATAGAACATGATTACTTTCCTTAG
Predicted protein sequences of Glyma02g40460
>Glyma02g40460.1   sequence type=predicted peptide   gene model=Glyma02g40460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRVRASFFVLFSLSCLLCVLLSSAQQLPPDAVVSARLLDSHLQDSAFRALFSPITGVPYDAQVPTNLSGIKVSAMRLRSGSLRTRGVLSYKEFEIPIGVVEKPYVERLVLVYQNLGNWSDQFYPLPGFSYLAPVLGLLAYSGINLSASELPELDIRASEKPVLVNFPHVRPAPLGALAKCVYFDLHGSVQFDTLLPGNVCSTMQQGHFSIVVESNAPSPAPSSGGEFQDASGKNNKKNNKFMLRILAPCVVGGIVLLIIILGLLVVLVRRHTKGTRMQQLECVAYSNEIMDMTSIGDIKVPLAFGTRTRPMIEHDYFP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo