SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G40300 | AT | Annotation by Michelle Graham. TAIR10: ferritin 4 | chr2:16831501-16833214 REVERSE LENGTH=259 | SoyBase | E_val: 1.00E-62 | ISS |
| GO:0000302 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species | SoyBase | N/A | ISS |
| GO:0006826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron ion transport | SoyBase | N/A | ISS |
| GO:0006879 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular iron ion homeostasis | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009908 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower development | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0010039 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to iron ion | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0016226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly | SoyBase | N/A | ISS |
| GO:0048366 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf development | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0055072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron ion homeostasis | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0008199 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ferric iron binding | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0046914 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transition metal ion binding | SoyBase | N/A | ISS |
| KOG2332 | KOG | Ferritin | JGI | ISS | |
| PTHR11431 | Panther | FERRITIN | JGI | ISS | |
| PTHR11431:SF8 | Panther | FERRITIN LIGHT CHAIN | JGI | ISS | |
| PF00210 | PFAM | Ferritin-like domain | JGI | ISS | |
| UniRef100_D7T4J5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ferritin n=1 Tax=Vitis vinifera RepID=D7T4J5_VITVI | SoyBase | E_val: 7.00E-63 | ISS |
| UniRef100_UPI000233AE23 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233AE23 related cluster n=1 Tax=unknown RepID=UPI000233AE23 | SoyBase | E_val: 6.00E-77 | ISS |
|
Glyma02g39615 not represented in the dataset |
Glyma02g39615 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g230400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g39615.1 sequence type=CDS gene model=Glyma02g39615 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTATGCCTACTTCGACAGAGACAATATTGCTCTGAAGGGATTGGCCAAATTTTTCAAGGAATCAAGTACGGAGGAAAGACAGCATGCTGAGATTATGATGGAATATCAAAATAAAAGAGGAGGCAGGGTTCAGCTGCAGTCAATGCTGATGCCATTTTCAAAATTTGATCACGCAGAAAAGGGTGATGCATTATATGGTTTTTATTTTTGTTTCACTATGCAGTTAGCAAATGAAAACAATGACGTTCAATTTGTTGACTTTCTAGAAAGCGAGTTTTTGGTTGGTCAGGTGGAAGACATTAAAAAGATCTCAGAATATGTGGCTCAGTTAAGAAGAATGGGCAGAGGACATGGTAATACTGTTTGGCACTTTGATCAGATGCTCCTTAATGGAGGTGTAGCTCCATGA
>Glyma02g39615.1 sequence type=predicted peptide gene model=Glyma02g39615 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MYAYFDRDNIALKGLAKFFKESSTEERQHAEIMMEYQNKRGGRVQLQSMLMPFSKFDHAEKGDALYGFYFCFTMQLANENNDVQFVDFLESEFLVGQVEDIKKISEYVAQLRRMGRGHGNTVWHFDQMLLNGGVAP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
