Glyma02g38660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g38660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g38660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g38660

Feature Type:	gene_model
Chromosome:	Gm02
Start:	44023949
stop:	44024421
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g38660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G08190	AT	Annotation by Michelle Graham. TAIR10: vacuolar protein sorting 41 \| chr1:2567652-2573142 FORWARD LENGTH=980	SoyBase	E_val: 1.00E-50	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0009630	GO-bp	Annotation by Michelle Graham. GO Biological Process: gravitropism	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR12616	Panther	VACUOLAR PROTEIN SORTING VPS41	JGI		ISS
PF00637	PFAM	Region in Clathrin and VPS	JGI		ISS
UniRef100_B9SCM9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting vps41, putative n=1 Tax=Ricinus communis RepID=B9SCM9_RICCO	SoyBase	E_val: 1.00E-52	ISS
UniRef100_UPI0002337533	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337533 related cluster n=1 Tax=unknown RepID=UPI0002337533	SoyBase	E_val: 9.00E-60	ISS

Expression Patterns of Glyma02g38660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g38660 not represented in the dataset	Glyma02g38660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g38660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g38660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g38660

Limit To All Plant Sequences

>Glyma02g38660.1   sequence type=CDS   gene model=Glyma02g38660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTAGAACTCTATACGGACTATGATCCAAAGATGTTGCTACCTTTTCTCCGTAGCAGTCAACACTACACCCTTGAGAAGGCTTACGAAATTTGCATTAAAAGAGACCTATTGAGGGAGCAAGTCTTCATCCTAGGAAGGATGGGAAACTCGAAGCAAGCCCTAGCTGTTATTATAAACAAATTGGGGGATGTAGAGGAGGCCGTAGAGTTTGTCACTATGCAGCATGATGATGAACTTTGGGAAGAATTAATCAAGCAATGTCTTCACAAACCTAAAATG

Predicted protein sequences of Glyma02g38660

Limit To All Plant Sequences

>Glyma02g38660.1   sequence type=predicted peptide   gene model=Glyma02g38660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VELYTDYDPKMLLPFLRSSQHYTLEKAYEICIKRDLLREQVFILGRMGNSKQALAVIINKLGDVEEAVEFVTMQHDDELWEELIKQCLHKPKM

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain