SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g38450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g38450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g38450

Feature Type:gene_model
Chromosome:Gm02
Start:43869387
stop:43871863
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26910AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L16p/L10e family protein | chr1:9321709-9322813 FORWARD LENGTH=221 SoyBaseE_val: 2.00E-145ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0032502GO-bp Annotation by Michelle Graham. GO Biological Process: developmental process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0857 KOG 60s ribosomal protein L10 JGI ISS
PTHR11726Panther 60S RIBOSOMAL PROTEIN L10 JGI ISS
PTHR11726:SF9Panther 60S RIBOSOMAL PROTEIN L10-LIKE JGI ISS
PF00252PFAM Ribosomal protein L16p/L10e JGI ISS
UniRef100_I3NMN6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L10B n=1 Tax=Hevea brasiliensis RepID=I3NMN6_HEVBR SoyBaseE_val: 6.00E-155ISS
UniRef100_UPI00018C6BFAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C6BFA related cluster n=1 Tax=unknown RepID=UPI00018C6BFA SoyBaseE_val: 8.00E-163ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g38450 not represented in the dataset

Glyma02g38450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g220000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g38450.1   sequence type=CDS   gene model=Glyma02g38450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCGAAGACCCGCGAGGTGTTATAGGCAAATTAAGAACAAACCATACCCCAAGTCACGGTTTTGCCGTGGTGTTCCTGATCCCAAGATCAGGATTTACGATGTTGGTATGAAGAAGAAGGGTGTTGATGAATTTCCTTTCTGTGTCCATCTGGTTAGTTGGGAGAAGGAAAACGTTTCTAGTGAGGCCCTGGAAGCTGCTCGTATTGCTTGCAACAAGTACATGGCCAAATTTGCTGGAAAGGATGCTTTCCACTTGAGAGTCAGGGTGCACCCATTCCATGTTCTTAGGATCAACAAGATGCTTTCGTGTGCCGGAGCTGATAGGCTCCAAACTGGAATGAGAGGTGCTTTTGGAAAGCCACAGGGTACTTGTGCTAGAGTGGCTATTGGACAGGTCCTTCTTTCTGTCCGCTGCAAGGACAGCAACAGCCATCATGCCCAGGAGGCCCTTCGCCGTGCCAAGTTCAAGTTCCCTGGTCGTCAAAAGATTATTGTTAGCAGGAAATGGGGCTTCACCAAGTTTAGCCGTTCTGATTATCTCAAGTTCAAGTCAGAGAATAGAATTGTGCCCGATGGTGTGAATGCTAAGCTTCTTGGTTGCCATGGACCATTGGCCAACCGTGAACCCGGAAGGGCCTTTTTGGATACTGCTACTGGTTCTTAG

>Glyma02g38450.1   sequence type=predicted peptide   gene model=Glyma02g38450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRSDYLKFKSENRIVPDGVNAKLLGCHGPLANREPGRAFLDTATGS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo