SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g37990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g37990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g37990

Feature Type:gene_model
Chromosome:Gm02
Start:43290225
stop:43291465
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70170AT Annotation by Michelle Graham. TAIR10: matrix metalloproteinase | chr1:26424005-26425141 FORWARD LENGTH=378 SoyBaseE_val: 3.00E-82ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0031012GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0004222GO-mf Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity SoyBaseN/AISS
GO:0008237GO-mf Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR10201Panther MATRIX METALLOPROTEINASE JGI ISS
PTHR10201:SF15Panther MATRIX METALLOPROTEINASE-RELATED JGI ISS
PF00413PFAM Matrixin JGI ISS
PF01471PFAM Putative peptidoglycan binding domain JGI ISS
UniRef100_I1JH15UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JH15_SOYBN SoyBaseE_val: 0ISS
UniRef100_P29136UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metalloendoproteinase 1 n=1 Tax=Glycine max RepID=MEP1_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g37990 not represented in the dataset

Glyma02g37990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g215700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g37990.1   sequence type=CDS   gene model=Glyma02g37990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCTCCGCAACCACCAAGAGCTCTTGGTTGCTCTTGCAATTCTATATTTTCTTGCCACCTCACTCCCTTCAGTTTCAGCTCATGGCCCATATGCATGGGATGGGGAGGCCACATATAAATTCACTACTTACCACCCTGGCCAAAACTACAAAGGTTTATCCAATGTCAAAAACTACTTCCACCATCTCGGCTACATCCCCAATGCACCACACTTCGACGACAACTTCGATGACACCCTCGTATCTGCCATCAAAACCTACCAAAAGAATTACAACCTCAACGTCACCGGCAAGTTCGACATCAACACTCTTAAACAAATCATGACACCCCGGTGTGGCGTCCCCGACATAATAATCAACACAAACAAAACCACATCGTTTGGCATGATCTCGGACTATACCTTCTTCAAAGACATGCCGCGGTGGCAAGCTGGAACCACACAACTCACCTACGCTTTCTCCCCGGAGCCAAGACTTGATGACACTTTCAAAAGCGCGATTGCAAGGGCCTTCAGCAAGTGGACCCCAGTGGTGAACATCGCGTTCCAGGAGACGACGTCGTATGAAACAGCCAACATTAAGATTCTTTTCGCGAGTAAGAACCACGGTGATCCGTATCCTTTTGATGGTCCAGGTGGGATATTGGGCCATGCATTCGCTCCCACTGATGGGAGGTGCCACTTTGACGCCGACGAATATTGGGTGGCGTCTGGCGATGTCACCAAATCGCCGGTGACAAGTGCGTTTGACCTTGAATCTGTGGCAGTGCACGAGATCGGGCACTTGCTCGGATTAGGCCACTCGTCGGACCTAAGAGCCATCATGTATCCTTCTATACCACCTCGAACTAGGAAGGTGAATCTAGCGCAAGATGATATAGACGGGATTCGAAAGCTCTATGGTATCAACCCCTAA

>Glyma02g37990.1   sequence type=predicted peptide   gene model=Glyma02g37990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLRNHQELLVALAILYFLATSLPSVSAHGPYAWDGEATYKFTTYHPGQNYKGLSNVKNYFHHLGYIPNAPHFDDNFDDTLVSAIKTYQKNYNLNVTGKFDINTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPPRTRKVNLAQDDIDGIRKLYGINP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo