SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g37680

Feature Type:gene_model
Chromosome:Gm02
Start:43042726
stop:43044203
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g37680
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49700AT Annotation by Michelle Graham. TAIR10: Predicted AT-hook DNA-binding family protein | chr5:20192599-20193429 FORWARD LENGTH=276 SoyBaseE_val: 5.00E-91ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF03479PFAM Domain of unknown function (DUF296) JGI ISS
UniRef100_B9RJW1UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RJW1_RICCO SoyBaseE_val: 3.00E-91ISS
UniRef100_I1JGZ4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JGZ4_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g37680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g37680
ParalogEvidenceComments
Glyma14g35980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g37680 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g213500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g37680
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g37680
>Glyma02g37680.1   sequence type=CDS   gene model=Glyma02g37680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTCAAAGCTTCAGCCACAACACCAGCAACAGCATCAACCTTTTCAATTCTCTCGTGAATGTCAAACGTCCGAGGACGATGACAGCCGAAGCAGCGGTGGCCCTAACACCGCCGTCGCCCAAAAATCAGTTTTAGGCGGCGGAGGATGCAGCGATGGGGCCACAATTGAAGTGGTGCGGCGGCCCAGGGGCCGCCCGCCCGGGTCCAAGAACAGGCCCAAGCCGCCTCTCATAATAACGCGCGAGCCCGAGCCCGCCATGAGCCCGTTCATTCTAGAAATCCCGGGCGGAAGCGACGTCGTCGAAGCCCTAGCCCGGTTCAGCCGCAGAAAAAACACTGGCCTGTGCGTGTTAACCGGTTCGGGAACCGTCGCCAACGTCACTCTCCGTCAACCTTCTTTCTCTCCCGCCGGCGCCACCGTCGCCACCGTCACTTTCCACGGCCGCTTCGATATCCTCTCCATGTCCGCCACCTTCCTCCACCACGCCTCCCCGGCGGCGATCCCGAACGCCTTCGCCGTGTCCCTTTCCGGACCGCAGGGGCAGATCGTCGGCGGATTCGTCGCCGGCAGGCTCCTCGCGGCCGGCACGGTGTTCGTGATTGCCGCGTCGTTCAACAATCCGTCGTATCACCGGCTTTCGTCGGAGGAGGAGGCGCAGAACAACTCTGGCGGCGGCGCAGGAGACGCGCAGTCTCCGCCGGTTTCCGGTGGCGGCTTGGAGAGCGGACACGTTCCGGCTGAGTCGTTTATGTACAGCTGTCACCTTCCTTCGGATGTGATTTGGGCTCCAACCCCTAGACCACCTTTCTGA
Predicted protein sequences of Glyma02g37680
>Glyma02g37680.1   sequence type=predicted peptide   gene model=Glyma02g37680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSKLQPQHQQQHQPFQFSRECQTSEDDDSRSSGGPNTAVAQKSVLGGGGCSDGATIEVVRRPRGRPPGSKNRPKPPLIITREPEPAMSPFILEIPGGSDVVEALARFSRRKNTGLCVLTGSGTVANVTLRQPSFSPAGATVATVTFHGRFDILSMSATFLHHASPAAIPNAFAVSLSGPQGQIVGGFVAGRLLAAGTVFVIAASFNNPSYHRLSSEEEAQNNSGGGAGDAQSPPVSGGGLESGHVPAESFMYSCHLPSDVIWAPTPRPPF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo