Glyma02g37251 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g37251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g37251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g37251

Feature Type:	gene_model
Chromosome:	Gm02
Start:	42578891
stop:	42589194
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g37251

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01050	AT	Annotation by Michelle Graham. TAIR10: pyrophosphorylase 1 \| chr1:31382-32670 REVERSE LENGTH=212	SoyBase	E_val: 9.00E-58	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0019915	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid storage	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0004427	GO-mf	Annotation by Michelle Graham. GO Molecular Function: inorganic diphosphatase activity	SoyBase	N/A	ISS
PTHR10286	Panther	INORGANIC PYROPHOSPHATASE	JGI		ISS
PF00719	PFAM	Inorganic pyrophosphatase	JGI		ISS
UniRef100_G8A0L7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Soluble inorganic pyrophosphatase n=1 Tax=Medicago truncatula RepID=G8A0L7_MEDTR	SoyBase	E_val: 7.00E-57	ISS
UniRef100_I1LKL6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LKL6_SOYBN	SoyBase	E_val: 8.00E-71	ISS

Expression Patterns of Glyma02g37251

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g37251 not represented in the dataset	Glyma02g37251 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g37251 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g209900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g37251

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g37251

Limit To All Plant Sequences

>Glyma02g37251.1   sequence type=CDS   gene model=Glyma02g37251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTTGATTCAAGAGGCTCTTTTGTGGAGAGGCAAGCAGTGGTCTCTAGAAATAATTATGAGTGACAATGGTGAAGAAGCTGGAGAAAATCGTCTAGTTCCCCGTTTGAATGAAAGGATTCTTTCATCATTGTCAAGGAGATCAGTAGCTGCCCATCCTTGGCATGATCTAGAAATTGGACCTGAGGCTCCTCAGATTTTCAATTGTGTTGTGGAGATCACTAAAGGAAGCAAGGTTAAGTATGAACTTGACAAAAAGACTGGATTGATTAAGGTTGATCGGGTTTTGTATTCATCAGTTGTTTATCCACATAACTATGGTTTTATCCCTCGCACACTGTGTGAAGACAATGATCCAATTGACAAAATTCATTCTAAGACAAAAAGAATGAGCACAAGGAGGTAG

Predicted protein sequences of Glyma02g37251

Limit To All Plant Sequences

>Glyma02g37251.1   sequence type=predicted peptide   gene model=Glyma02g37251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLIQEALLWRGKQWSLEIIMSDNGEEAGENRLVPRLNERILSSLSRRSVAAHPWHDLEIGPEAPQIFNCVVEITKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDKIHSKTKRMSTRR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain