SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g36220): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g36220): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g36220

Feature Type:gene_model
Chromosome:Gm02
Start:41610593
stop:41618447
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06140AT Annotation by Michelle Graham. TAIR10: sorting nexin 1 | chr5:1856212-1858752 REVERSE LENGTH=402 SoyBaseE_val: 0ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006896GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi to vacuole transport SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0008333GO-bp Annotation by Michelle Graham. GO Biological Process: endosome to lysosome transport SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0009958GO-bp Annotation by Michelle Graham. GO Biological Process: positive gravitropism SoyBaseN/AISS
GO:0010252GO-bp Annotation by Michelle Graham. GO Biological Process: auxin homeostasis SoyBaseN/AISS
GO:0016197GO-bp Annotation by Michelle Graham. GO Biological Process: endosomal transport SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005771GO-cc Annotation by Michelle Graham. GO Cellular Compartment: multivesicular body SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030904GO-cc Annotation by Michelle Graham. GO Cellular Compartment: retromer complex SoyBaseN/AISS
GO:0043231GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG2273 KOG Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins JGI ISS
PTHR10555Panther SORTING NEXIN JGI ISS
PTHR10555:SF65Panther PHOX (PX) DOMAIN-CONTAINING PROTEIN JGI ISS
PF00787PFAM PX domain JGI ISS
PF09325PFAM Vps5 C terminal like JGI ISS
UniRef100_B9SWH8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sorting nexin 3, putative n=1 Tax=Ricinus communis RepID=B9SWH8_RICCO SoyBaseE_val: 0ISS
UniRef100_I1JGL9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JGL9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g36220 not represented in the dataset

Glyma02g36220 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g08700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g201400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g36220.2   sequence type=CDS   gene model=Glyma02g36220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACCCGCCCCGCCACCCACCGTGGGCCCGATCAAATAGTGTAGCCGGCCAATCCAACTCCCCAAGCGGCAACCAGTTTCACTCTCTTCTCTTCAGCAAACCACGTTTTTCTGCGGTGCCACTGCGACACTCGCTGGCCCCCAAAACGACCATGAACATGAACCCCCCGCAGAGAACTCTCTCCGGTTCGTCGCAGAGCCCTAGATCTCCGTCTTCGTCGTCGCAACCTTTTCTCTCCGTCTCCGTCACCGATCCCGTTAAGCTCGGCAATGGCGTCCAAGCCTATATCTCCTACCGCGTCATCACCAAAACAAATTTTCCTGAATACCAAGGACCTGAGAAGATTGTCATCCGACGTTACAGTGACTTTGTCTGGTTACGTGATCGCCTTTTTGAGAAGTACAAAGGCATTTTCATTCCCCCTCTTCCAGAGAAAAGTGCTGTAGAGAAATTTCGTTTCAGTGCTGAATTTATTGAAATGAGGCGGCAAGCATTGGATGTATTTGTAAATAGGATAGCATCACATCATGAACTTCAACAAAGTGAGGACCTGAGGTTGTTTTTGCAGGCAGAGGAAGAGACAATGGAACGATTAAGGTCACACGAGACTGGCATATTCAAGAAGAAACCAGCTGATCTAATGCAGATTTTTAAGGATGTGCAATCTAAAGTCAGTGATGTTGTCCTTGGGAAAGAGAAGCCAGTAGAAGAATCAAATCCTGAGTATGAAAAAATGAAACATTACATCTTTGAGCTTGAAAACCACTTGGCTGAAGCTCAAAAGCATGCATACCGTCTTGTGAAGAGGCACAGAGAGTTGGGGCAATCACTGTCTGATTTTGGAAAAGCAGTAAAACTTCTAGGTGCTTCTGAAGGAAATGCTCTTGGAAAAGCATTCTCTGAACTTGGGATGAAGTCAGAGATTTTATCAGCCAAGTTGCAAAAGGAGGCTCATCAGCTCTTGATGAATTTTGAAGAACCTTTGAAAGATTATGTCCGTGCGGTACAATCTATTAAGGCAACAATAGCAGAGAGGGCCAATGCCTTCAGAAGACAATGTGAACTGGCTGAAACAATGAAGCTAAAGGAGATTAATCTTGACAAGCTCATGCTGATTCGATCTGATAAAGTTGCAGAAGCTGAGCATGAATATAAAGAGTTGAAGGCAGAGAGTGAACAGGCGACGAAGACATTTGAGATGATTGTGAAACTAATGAATGAAGAGATGGGTCGTTTTCAGGAACAGAAAACATTAGATATGGGGATTGCTTTCCATGAATTTGCCAAAGGTCAGGCACGTCTAGCAAATGGTATTGCAGACGCATGGCGAAGTTTGCTTCCTAAACTGGAAGCATGTTCCACCTCATAG

>Glyma02g36220.2   sequence type=predicted peptide   gene model=Glyma02g36220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYPPRHPPWARSNSVAGQSNSPSGNQFHSLLFSKPRFSAVPLRHSLAPKTTMNMNPPQRTLSGSSQSPRSPSSSSQPFLSVSVTDPVKLGNGVQAYISYRVITKTNFPEYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRQALDVFVNRIASHHELQQSEDLRLFLQAEEETMERLRSHETGIFKKKPADLMQIFKDVQSKVSDVVLGKEKPVEESNPEYEKMKHYIFELENHLAEAQKHAYRLVKRHRELGQSLSDFGKAVKLLGASEGNALGKAFSELGMKSEILSAKLQKEAHQLLMNFEEPLKDYVRAVQSIKATIAERANAFRRQCELAETMKLKEINLDKLMLIRSDKVAEAEHEYKELKAESEQATKTFEMIVKLMNEEMGRFQEQKTLDMGIAFHEFAKGQARLANGIADAWRSLLPKLEACSTS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo