SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g35990

Feature Type:gene_model
Chromosome:Gm02
Start:41377640
stop:41380993
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g35990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52560AT Annotation by Michelle Graham. TAIR10: ubiquitin E2 variant 1D-4 | chr3:19494678-19495954 REVERSE LENGTH=146 SoyBaseE_val: 9.00E-102ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006301GO-bp Annotation by Michelle Graham. GO Biological Process: postreplication repair SoyBaseN/AISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0031372GO-cc Annotation by Michelle Graham. GO Cellular Compartment: UBC13-MMS2 complex SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
KOG0896 KOG Ubiquitin-conjugating enzyme E2 JGI ISS
PTHR24067Panther UBIQUITIN-CONJUGATING ENZYME E2 JGI ISS
PTHR24067:SF8Panther SUBFAMILY NOT NAMED JGI ISS
PF00179PFAM Ubiquitin-conjugating enzyme JGI ISS
UniRef100_E9JFV5UniRef Annotation by Michelle Graham. Best UniRef hit: Ubiquitin-conjugating family protein n=3 Tax=fabids RepID=E9JFV5_9ROSI SoyBaseE_val: 4.00E-105ISS
UniRef100_E9JFV5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating family protein n=3 Tax=fabids RepID=E9JFV5_9ROSI SoyBaseE_val: 4.00E-105ISS

Expression Patterns of Glyma02g35990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g35990
ParalogEvidenceComments
Glyma10g09280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g35990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g199700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g35990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g35990
>Glyma02g35990.1   sequence type=CDS   gene model=Glyma02g35990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGCTTGGCTCAGGAGGATCCAGTGTCGTTGTTCCTAGGAACTTCAGATTGCTGGAGGAGCTTGAACGTGGTGAAAAAGGAATTGGAGATGGCACAGTTAGCTATGGAATGGATGATGGTGATGACATTTACATGCGCTCTTGGACTGGCACGATTATTGGCCCCCATAATACTGTACATGAAGGAAGAATTTATCAACTGAAGCTGTTTTGTGATAAAGACTACCCAGAAAAGCCCCCTAGTGTTCGGTTTCATTCACGGATCAACATGACTTGTGTTAATCATGAAACTGGAGTGGTTGAACCAAAGAAATTTGGTCTTCTTGCAAATTGGCAAAGAGAGTACACCATGGAGGACATACTGACCCAGCTGAAGAAGGAAATGGCCGCTCCTCATAACCGGAAGCTTGTCCAACCTCCAGAAGGTACCTACTTTTAG
Predicted protein sequences of Glyma02g35990
>Glyma02g35990.1   sequence type=predicted peptide   gene model=Glyma02g35990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLANWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGTYF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo