SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g35951): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g35951): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g35951

Feature Type:gene_model
Chromosome:Gm02
Start:41326266
stop:41326844
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30960AT Annotation by Michelle Graham. TAIR10: SOS3-interacting protein 3 | chr4:15067400-15068725 FORWARD LENGTH=441 SoyBaseE_val: 2.00E-102ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0010540GO-bp Annotation by Michelle Graham. GO Biological Process: basipetal auxin transport SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24343Panther SERINE/THREONINE KINASE JGI ISS
PTHR24343:SF45Panther SERINE/THREONINE-PROTEIN KINASE PTK1,2/STK1,2 JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_B0I554UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase n=1 Tax=Phaseolus vulgaris RepID=B0I554_PHAVU SoyBaseE_val: 1.00E-121ISS
UniRef100_UPI000233A6ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A6AD related cluster n=1 Tax=unknown RepID=UPI000233A6AD SoyBaseE_val: 4.00E-127ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g35951 not represented in the dataset

Glyma02g35951 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g199400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g35951.1   sequence type=CDS   gene model=Glyma02g35951   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAACAGGGCAACACGTGGCCATGAAGGTGGTGGGAAAAGAAAAGGTGATAAAGGTCGGAATGATGGAGCAGGTGAAGAAGGAGATCTCGGTGATGAAGATGGTGAAGCACCAAAACATCGTCGAACTCCACGAAGTCATGGCCAGCAAGTCCAAGATCTATATTGCCATGGAACTCGTCCGCGGCGGAGAGCTCTTCAACAAGGTCTCTAAAGGCCGCTTAAAGGAGGACGTGGCAAGACTTTACTTCCAGCCGTTAATCTCCGCCGTCGACTTCTGCCACAGTCGTGGCGTCTACCACCGCGACCTCAAGCCGGAAAACCTCCTCCTGGACGAACACGACAACCTCAAAGTCTCCGACTTCGGACTCACCGCTTTCTCCGAACACCTCAAGGAGGACGGGCTGTTACACACCACGTGCGGCATGCCTGCGTCACCTGAAGTGATAGCGAAAAAAGGCTATGACGGTGCCAAGGCTGACATATGGTCATGTGGTGTAATCCTCTACGTTCTCCTCGCAGGCTTTTTACCCTTTCAGGATGATAATTTGGTTGCCATGATAATTTGGTGGGGTTAA

>Glyma02g35951.1   sequence type=predicted peptide   gene model=Glyma02g35951   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTGQHVAMKVVGKEKVIKVGMMEQVKKEISVMKMVKHQNIVELHEVMASKSKIYIAMELVRGGELFNKVSKGRLKEDVARLYFQPLISAVDFCHSRGVYHRDLKPENLLLDEHDNLKVSDFGLTAFSEHLKEDGLLHTTCGMPASPEVIAKKGYDGAKADIWSCGVILYVLLAGFLPFQDDNLVAMIIWWG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo