Glyma02g35841 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g35841): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g35841): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g35841

Feature Type:	gene_model
Chromosome:	Gm02
Start:	41113263
stop:	41113950
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g35841

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G66950	AT	Annotation by Michelle Graham. TAIR10: pleiotropic drug resistance 11 \| chr1:24978239-24984461 FORWARD LENGTH=1454	SoyBase	E_val: 2.00E-38	ISS
GO:0000302	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species	SoyBase	N/A	ISS
GO:0006855	GO-bp	Annotation by Michelle Graham. GO Biological Process: drug transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
GO:0042626	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances	SoyBase	N/A	ISS
PTHR19241	Panther	ATP-BINDING CASSETTE TRANSPORTER	JGI		ISS
PTHR19241:SF96	Panther		JGI		ISS
PF01061	PFAM	ABC-2 type transporter	JGI		ISS
UniRef100_B9T195	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP-binding cassette transporter, putative n=1 Tax=Ricinus communis RepID=B9T195_RICCO	SoyBase	E_val: 1.00E-40	ISS
UniRef100_I1NAL0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAL0_SOYBN	SoyBase	E_val: 1.00E-49	ISS

Expression Patterns of Glyma02g35841

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g35841 not represented in the dataset	Glyma02g35841 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g35841 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g35841

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g35841

Limit To All Plant Sequences

>Glyma02g35841.1   sequence type=CDS   gene model=Glyma02g35841   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCATTTGGTTTGCCTATATGCTTCTCAGGATCCCTCTGTACATTATGGAATTAGGGATATGGATTGCCCATACATATTACACCATAGGGTTTGCTCCTTCTGCTAGCAGATTTATCCGGCAATTCTTGGCATTATTTGGCATTCATCAGATGGCTCTCTCTTTATTTCGGTTCCTTGCTGCAGCTGGTAGAACACTAGTTGTTGCTAATACACTGGGTACCTTGTTCCTGCAATTGGTATTTGTGCTAGGAGGTTTTGTTATTGCTAAAGATGACATTGAGCCATGGATGATCTGGGGCTATTATATATAG

Predicted protein sequences of Glyma02g35841

Limit To All Plant Sequences

>Glyma02g35841.1   sequence type=predicted peptide   gene model=Glyma02g35841   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGIWFAYMLLRIPLYIMELGIWIAHTYYTIGFAPSASRFIRQFLALFGIHQMALSLFRFLAAAGRTLVVANTLGTLFLQLVFVLGGFVIAKDDIEPWMIWGYYI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain