Glyma02g35830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g35830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g35830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g35830

Feature Type:	gene_model
Chromosome:	Gm02
Start:	41107404
stop:	41109286
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g35830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19430	AT	Annotation by Michelle Graham. TAIR10: DWD (DDB1-binding WD40 protein) hypersensitive to ABA 1 \| chr2:8415217-8417740 FORWARD LENGTH=367	SoyBase	E_val: 1.00E-37	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0009788	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010100	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of photomorphogenesis	SoyBase	N/A	ISS
GO:0010267	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0031047	GO-bp	Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA	SoyBase	N/A	ISS
GO:0048608	GO-bp	Annotation by Michelle Graham. GO Biological Process: reproductive structure development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0080008	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR26208	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR26208:SF80	Panther		JGI		ISS
PF00400	PFAM	WD domain, G-beta repeat	JGI		ISS
UniRef100_B9RK89	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dead box ATP-dependent RNA helicase, putative n=1 Tax=Ricinus communis RepID=B9RK89_RICCO	SoyBase	E_val: 1.00E-44	ISS
UniRef100_C6T947	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T947_SOYBN	SoyBase	E_val: 8.00E-60	ISS

Expression Patterns of Glyma02g35830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g35830 not represented in the dataset	Glyma02g35830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g35830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g198600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g35830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g35830

Limit To All Plant Sequences

>Glyma02g35830.1   sequence type=CDS   gene model=Glyma02g35830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGGAAGAAAAACAAGTGGATGCATTGAAGGAAGTATTACCATCTCATAAGGCTTTGTGTACCGCTCTTACAATTATATTTGATGAATCTTGTGGGAACCATGTATGTTGCTATGCGTTTTCTTGGAGCCATGAATGCTTCATCAGTTCAACCAGTTGTTGCTATCGAAAGAACTATCTTCTATCATTAATGTTTATGTCTTTCAGAGGTCCTTGGGGTGCACTTTCACCTATCCCTGAGAATAATGTTATTGCTGTCAATACTCAGGTTTGGGGATCTGTTTTTGCCGCATCTGGTGATTCTTGTGCATATTGTTGGGATGTGGAAACTGGTAAAGTGAAAATGGTATTCAAGGGGCACATGGACTATTTGTATTGTATAGTTGCTCGCAACTCATCAAATCAGATCATAACAGGTTCGGAGGATGGGACAACACTAATTTGGTGTACGCAAGTGATTGATCCAACAAGAGATTTGAAATTAAAGGGATCTACTTCATGGGTTGGTTGTGTTGCTTTAGATGCAAGTGGAAGTCGGTTG

Predicted protein sequences of Glyma02g35830

Limit To All Plant Sequences

>Glyma02g35830.1   sequence type=predicted peptide   gene model=Glyma02g35830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LEEKQVDALKEVLPSHKALCTALTIIFDESCGNHVCCYAFSWSHECFISSTSCCYRKNYLLSLMFMSFRGPWGALSPIPENNVIAVNTQVWGSVFAASGDSCAYCWDVETGKVKMVFKGHMDYLYCIVARNSSNQIITGSEDGTTLIWCTQVIDPTRDLKLKGSTSWVGCVALDASGSRL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain