SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g35780

Feature Type:gene_model
Chromosome:Gm02
Start:41062410
stop:41066100
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g35780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06290AT Annotation by Michelle Graham. TAIR10: 2-cysteine peroxiredoxin B | chr5:1919380-1921211 FORWARD LENGTH=273 SoyBaseE_val: 3.00E-140ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0010319GO-cc Annotation by Michelle Graham. GO Cellular Compartment: stromule SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0016209GO-mf Annotation by Michelle Graham. GO Molecular Function: antioxidant activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0051920GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxiredoxin activity SoyBaseN/AISS
KOG0852 KOG Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes JGI ISS
PTHR10681Panther PEROXIREDOXIN JGI ISS
PF00578PFAM AhpC/TSA family JGI ISS
PF10417PFAM C-terminal domain of 1-Cys peroxiredoxin JGI ISS
UniRef100_F1C3E5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 2-Cys peroxiredoxin n=1 Tax=Caragana jubata RepID=F1C3E5_9FABA SoyBaseE_val: 7.00E-155ISS
UniRef100_UPI0001CAE6EFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001CAE6EF related cluster n=1 Tax=unknown RepID=UPI0001CAE6EF SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g35780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g35780
ParalogEvidenceComments
Glyma10g09470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g35780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g198400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g35780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g35780
>Glyma02g35780.1   sequence type=CDS   gene model=Glyma02g35780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATGCTCAGCCACCTCTGCTTCCCTCTTCTCCGCAAACCCAACACCCCTCTTCTCTCCCAAACCCTCTCTCTCCCTCCACCTTAACCCTCTCCCCACGCGCCCTTCTCCCTCCCTCACGCGCCCTTCTCTCTCCCTCACGCGCCCTTCTCACTCTCGCCGCTCCTTCGTTGTCAAAGCCTCCTCCAGCGAGCTTCCGCTGGTTGGTAACACCGCACCGGATTTCGAAGCAGAGGCTGTGTTTGACCAGGAGTTTATCAACGTGAAACTATCTGATTACATTGGGAAGAAATATGTTGTGCTCTTCTTCTACCCGTTGGACTTCACCTTTGTCTGCCCCACAGAAATCACTGCTTTCAGTGACCGACATGCAGAGTTCGAGGCACTAAATACTGAGATATTGGGTGTTTCAGTTGACAGTGTGTTCTCGCACCTTGCATGGATCCAAACAGATAGAAAGTCAGGTGGCCTTGGTGACTTGAACTATCCTTTGATTTCTGATGTCACCAAATCCATATCGAAATCTTATGGTGTTCTCATTCCTGATCAGGGAATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTTATTCAGCATTCTACCATTAACAACTTGGCAATTGGTAGAAGTGTTGACGAGACAAAGAGAACTCTCCAGGCCTTACAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCTGCTGGGTGGAAGCCTGGGGAGAAGTCCATGAAACCAGACCCTAAACTTAGCAAAGACTACTTTGCAGCGGTGTAG
Predicted protein sequences of Glyma02g35780
>Glyma02g35780.1   sequence type=predicted peptide   gene model=Glyma02g35780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACSATSASLFSANPTPLFSPKPSLSLHLNPLPTRPSPSLTRPSLSLTRPSHSRRSFVVKASSSELPLVGNTAPDFEAEAVFDQEFINVKLSDYIGKKYVVLFFYPLDFTFVCPTEITAFSDRHAEFEALNTEILGVSVDSVFSHLAWIQTDRKSGGLGDLNYPLISDVTKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKDYFAAV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo