Glyma02g35740 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g35740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g35740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g35740

Feature Type:	gene_model
Chromosome:	Gm02
Start:	40977921
stop:	40979765
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g35740

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63250	AT	Annotation by Michelle Graham. TAIR10: homocysteine methyltransferase 2 \| chr3:23370575-23371974 REVERSE LENGTH=293	SoyBase	E_val: 2.00E-40	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0006306	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA methylation	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0009616	GO-bp	Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing	SoyBase	N/A	ISS
GO:0010050	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative phase change	SoyBase	N/A	ISS
GO:0033528	GO-bp	Annotation by Michelle Graham. GO Biological Process: S-methylmethionine cycle	SoyBase	N/A	ISS
GO:0043687	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-translational protein modification	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0051567	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0008898	GO-mf	Annotation by Michelle Graham. GO Molecular Function: homocysteine S-methyltransferase activity	SoyBase	N/A	ISS
PTHR21091	Panther	METHYLTETRAHYDROFOLATE:HOMOCYSTEINE METHYLTRANSFERASE RELATED	JGI		ISS
PTHR21091:SF6	Panther	5-METHYLTETRAHYDROFOLATE:HOMOCYSTEINE METHYLTRANSFERASE	JGI		ISS
PF02574	PFAM	Homocysteine S-methyltransferase	JGI		ISS
UniRef100_F8QPI4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Selenocysteine methyltransferase n=1 Tax=Astragalus chrysochlorus RepID=F8QPI4_9FABA	SoyBase	E_val: 5.00E-43	ISS
UniRef100_UPI000233A336	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A336 related cluster n=1 Tax=unknown RepID=UPI000233A336	SoyBase	E_val: 5.00E-51	ISS

Expression Patterns of Glyma02g35740

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g35740 not represented in the dataset	Glyma02g35740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g35740 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g35740

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g35740

Limit To All Plant Sequences

>Glyma02g35740.1   sequence type=CDS   gene model=Glyma02g35740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGGTTGGGGTTTGATAAAAAGAGTTCAAATTTTAGCAGATTCAAGTGTTGACCTGCTTGCATTTGAAACAGTGCCCAATAAGCTTGAAGCTGAGGTACAAAATAATAGTTATCTAAAGCTAAATATTATTAATGTTGTTAGTGGTGATTCTTTAATGGAATGTGGCTCTATTGCTGAATCAGGTAATAAAGTTGTCGCTGTTGGAATCAACTGTACCCCACCAAGATTTATACATGGTCTAATTGTTTTGCTTAAGAGGGTGACTACAAAACCAATTGTTATATATCCAAACAGTGGGGAAACTTACGATGCTGACCTAAAGGAGTGGGTG

Predicted protein sequences of Glyma02g35740

Limit To All Plant Sequences

>Glyma02g35740.1   sequence type=predicted peptide   gene model=Glyma02g35740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKGWGLIKRVQILADSSVDLLAFETVPNKLEAEVQNNSYLKLNIINVVSGDSLMECGSIAESGNKVVAVGINCTPPRFIHGLIVLLKRVTTKPIVIYPNSGETYDADLKEWV

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain