Glyma02g35270 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g35270

Feature Type:	gene_model
Chromosome:	Gm02
Start:	40010022
stop:	40010362
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g35270

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G02890	AT	Annotation by Michelle Graham. TAIR10: AAA-type ATPase family protein \| chr1:645372-651797 REVERSE LENGTH=1246	SoyBase	E_val: 1.00E-16	ISS
GO:0009630	GO-bp	Annotation by Michelle Graham. GO Biological Process: gravitropism	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
UniRef100_G7IF85	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Katanin p60 ATPase-containing subunit n=1 Tax=Medicago truncatula RepID=G7IF85_MEDTR	SoyBase	E_val: 2.00E-14	ISS
UniRef100_I1JFI0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JFI0_SOYBN	SoyBase	E_val: 5.00E-17	ISS

Expression Patterns of Glyma02g35270

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g35270 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g35270

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g35270

Limit To All Plant Sequences

>Glyma02g35270.1   sequence type=CDS   gene model=Glyma02g35270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCGGGGCAAAGTTCTGCTTGCTTTTGAAGATAATAAGGTCTTCAAAAATTGGGGTTAGGTTTGATAAATCAATTCCAGATGGCAATGATCTTGGAGGCCTTTGTGAGGATGATCATGGTTCTGGAGGGGATGATGCAGATAAAGTTGCAATTAATTATATTTTTGAGGTTGTGCCAGTTCTTTACCGGTCCAAAAGATGCCTCTATTCCTGA

Predicted protein sequences of Glyma02g35270

Limit To All Plant Sequences

>Glyma02g35270.1   sequence type=predicted peptide   gene model=Glyma02g35270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPGAKFCLLLKIIRSSKIGVRFDKSIPDGNDLGGLCEDDHGSGGDDADKVAINYIFEVVPVLYRSKRCLYS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain