SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g35040

Feature Type:gene_model
Chromosome:Gm02
Start:39793423
stop:39795789
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g35040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11780AT Annotation by Michelle Graham. TAIR10: MD-2-related lipid recognition domain-containing protein / ML domain-containing protein | chr3:3724326-3725476 REVERSE LENGTH=153 SoyBaseE_val: 2.00E-60ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4680 KOG Uncharacterized conserved protein, contains ML domain JGI ISS
PTHR11306Panther NIEMANN PICK TYPE C2 PROTEIN NPC2-RELATED JGI ISS
PF02221PFAM ML domain JGI ISS
UniRef100_B9SDL0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphatidylglycerol/phosphatidylinositol transfer protein, putative n=1 Tax=Ricinus communis RepID=B9SDL0_RICCO SoyBaseE_val: 4.00E-63ISS
UniRef100_I1L9L9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9L9_SOYBN SoyBaseE_val: 2.00E-79ISS

Expression Patterns of Glyma02g35040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g35040
ParalogEvidenceComments
Glyma10g10310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g35040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g193900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g35040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g35040
>Glyma02g35040.1   sequence type=CDS   gene model=Glyma02g35040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGATAAGAAAGCTGACTATGATGTTGAGGTTAAAGGGGTTGAAATATATCCTGATCCCATCGCACGAGGCCAGCCTGCTACATTCAGCATTGCTGCAACTACAGGTAAAGCGTTATCTGGAGGGAAGCTAGCGATTGATGTGTCATATTTCGGATGGCACATACATAGTGAGACCCATGACCTTTGTGGAGAAACTACTTGCCCTGTTTCAGTTGGTGATTTTGTGATTGCTCATTCCCAAGTTTTACCAGGATTCACTCTACCTGTTTCATACTCTTTGAAGATGAAGATGTTCGATGGAAACAAGCATGAGTTAACTAACATTACATTTGGTTTTGATATTGGGTTTGGTTCTTCTGTGGCTGATAGCTAA
Predicted protein sequences of Glyma02g35040
>Glyma02g35040.1   sequence type=predicted peptide   gene model=Glyma02g35040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDKKADYDVEVKGVEIYPDPIARGQPATFSIAATTGKALSGGKLAIDVSYFGWHIHSETHDLCGETTCPVSVGDFVIAHSQVLPGFTLPVSYSLKMKMFDGNKHELTNITFGFDIGFGSSVADS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo