SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g34810

Feature Type:gene_model
Chromosome:Gm02
Start:39369123
stop:39369788
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g34810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13770AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR-like) superfamily protein | chr5:4445461-4447290 FORWARD LENGTH=609 SoyBaseE_val: 5.00E-93ISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_B9S796UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9S796_RICCO SoyBaseE_val: 9.00E-101ISS
UniRef100_I1JGE5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JGE5_SOYBN SoyBaseE_val: 8.00E-162ISS

Expression Patterns of Glyma02g34810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g34810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g192000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g34810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g34810
>Glyma02g34810.1   sequence type=CDS   gene model=Glyma02g34810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTAAGGTTTTCAAGGAGCTGATTTTCAAGGGTTATGAATCGGGTCAAGTCACCTATGCTTCAGTTATAAATGCATATTTCCATCTTGAGCAATATAGCAAAGCAGAAGAGGTATTTTTAGAGATGGAGCAAAAGGGGTTTGATAAATGTGTTTATGCTTACTCAACCATGATTGTGATGTATGGAAGAATGGGGAGGGTGACAAGCGCGATGAAGTTGGTAGCCAAGATGAAACAAAGAGGGTGCAAACCAAATGTGTGGATCTATAACTCCTTGATAGACATGCATAGGAGGGACAACAATTTGAAGCAGCTTGAAAAGCTGTGGAAAGAAATGAAGAGAAGAAGGGTAGCACCAGATAAGGTGAGTTATACTACCATCATTGGTGCTTATAGTAAAGCAGGTGAGTTTGAAACCTGTGTGAAGCTTTTCAACGAGTATAGGATGAATGGGGGGCTTATTGATAGGGCCATGGCAGGTATAATGGTTGGTGTGTTCTCTAAAGTTGGTCTGGTTGATGAATTGTTGAAACTCTTACAAGACATGAAAGCAGAAGGAAAAAGACTAGATCAGAGGCTGTACCAATCTGCTTGGAATGCTTTTAAAGATGTCGGGTTGCAAATTCAAGCAAGGTGGATGAAAGAGATCTTTTTTGTGACATAA
Predicted protein sequences of Glyma02g34810
>Glyma02g34810.1   sequence type=predicted peptide   gene model=Glyma02g34810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKVFKELIFKGYESGQVTYASVINAYFHLEQYSKAEEVFLEMEQKGFDKCVYAYSTMIVMYGRMGRVTSAMKLVAKMKQRGCKPNVWIYNSLIDMHRRDNNLKQLEKLWKEMKRRRVAPDKVSYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVDELLKLLQDMKAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo