SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g34766

Feature Type:gene_model
Chromosome:Gm02
Start:39271680
stop:39281622
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g34766
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57190AT Annotation by Michelle Graham. TAIR10: peptide chain release factor, putative | chr3:21166468-21168198 FORWARD LENGTH=406 SoyBaseE_val: 1.00E-117ISS
GO:0006415GO-bp Annotation by Michelle Graham. GO Biological Process: translational termination SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009772GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem II SoyBaseN/AISS
GO:0010190GO-bp Annotation by Michelle Graham. GO Biological Process: cytochrome b6f complex assembly SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0043488GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of mRNA stability SoyBaseN/AISS
GO:0048255GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA stabilization SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003730GO-mf Annotation by Michelle Graham. GO Molecular Function: mRNA 3'-UTR binding SoyBaseN/AISS
GO:0003747GO-mf Annotation by Michelle Graham. GO Molecular Function: translation release factor activity SoyBaseN/AISS
GO:0016149GO-mf Annotation by Michelle Graham. GO Molecular Function: translation release factor activity, codon specific SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG2726 KOG Mitochondrial polypeptide chain release factor JGI ISS
PTHR11075Panther PEPTIDE CHAIN RELEASE FACTOR JGI ISS
PTHR11075:SF4Panther gb def: protein releasing factor [caenorhabditis elegans] JGI ISS
PF00472PFAM RF-1 domain JGI ISS
PF03462PFAM PCRF domain JGI ISS
UniRef100_G7I3P7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptide chain release factor n=1 Tax=Medicago truncatula RepID=G7I3P7_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1JGE3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JGE3_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g34766
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g34766 not represented in the dataset
Glyma02g34766 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g34766
ParalogEvidenceComments
Glyma10g16420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g34766 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g191600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g34766
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g34766
>Glyma02g34766.1   sequence type=CDS   gene model=Glyma02g34766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTATGGGATTTTGATATGTGGAATGATCCAGCTAAGTCCAATGACATCATTGTCAAGTTGGAAAACAGTGCCAAAGTGGTTGATTCTCTAAGGGACTTGAAATACAAGGTAGAGGAAGCAAAGCTGATCAATCAGTTGGCTGAGATAAATGTTATTGATTATGGTCTTTATAAACAAGCATATGAAACATCATTGGATGTGAGTGAGATTCTAGATCAGTATGAGATTTCTAAGCTTCTTAAAGGGCCTTTCGATATGGCAGGAGCATGTTTGGTTATAAAAGCTGGACCTAATGGCATCTATTCAAAGCTCTGGGCAGAACAGATCCTAATCATGTATCTTAGATGGGCCAAAAGACAAGGTTATGCAGGAAGGATTGTTGACAAGTGTTTGTTCAAGAATGGAGGAATTAATTCTGCGATTATAGAGTTTGAATTTGAGTGTGCATATGGATATCTTTCAGGGGAGAAAGGAGTTCACTACATGATAAGAGGTTCTCCAAATGAATCTTCTCAGCTTGAGGCTAGCTCAGCAACTGTAGATGTTATTCCCATGTTCCTTGAGAATGCTTGTGATCTTGAAATTGATTCTGAGGATTTGATTATCTCATCTCCCTTGATTCATGGGGAAAACAAGAGACAAACTGATCATACAGTTTGCATTCAGCATATACCTACTGGCATAAGTGTCCAATCCTCTGGTGAGAGAAGCTACTTTGCAAATAAGATGAAAGCACTAAACAGACTGAAAGCTAAACTTCTAGTGACAGCAAAGGAACAAAGAGTTGCAAGTATAAAAAGTATACGGAAGGAAAACATCGTCAATCTATGGCAAGAAGAATTTCGGAGGTACATCTCTCATCCGTACAAGTTAGTACACGATGTAAAGACAGGCGTTGAGGTGCCAGACCTAAATAATGTTCTGGAGGGGAATATTGGACCTCTCATTGTAGCTCATATTAATAGCAGAGTCATGTCATAA
Predicted protein sequences of Glyma02g34766
>Glyma02g34766.1   sequence type=predicted peptide   gene model=Glyma02g34766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVWDFDMWNDPAKSNDIIVKLENSAKVVDSLRDLKYKVEEAKLINQLAEINVIDYGLYKQAYETSLDVSEILDQYEISKLLKGPFDMAGACLVIKAGPNGIYSKLWAEQILIMYLRWAKRQGYAGRIVDKCLFKNGGINSAIIEFEFECAYGYLSGEKGVHYMIRGSPNESSQLEASSATVDVIPMFLENACDLEIDSEDLIISSPLIHGENKRQTDHTVCIQHIPTGISVQSSGERSYFANKMKALNRLKAKLLVTAKEQRVASIKSIRKENIVNLWQEEFRRYISHPYKLVHDVKTGVEVPDLNNVLEGNIGPLIVAHINSRVMS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo