SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g34544): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g34544): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g34544

Feature Type:gene_model
Chromosome:Gm02
Start:38751968
stop:38753780
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g34544
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11030AT Annotation by Michelle Graham. TAIR10: AMP-dependent synthetase and ligase family protein | chr4:6738120-6742229 FORWARD LENGTH=666 SoyBaseE_val: 1.00E-18ISS
GO:0001676GO-bp Annotation by Michelle Graham. GO Biological Process: long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0002213GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to insect SoyBaseN/AISS
GO:0006631GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004467GO-mf Annotation by Michelle Graham. GO Molecular Function: long-chain fatty acid-CoA ligase activity SoyBaseN/AISS
UniRef100_G7KAK9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Annotation was added to scaffolds in November 2011 Long-chain-fatty-acid-CoA ligase n=1 Tax=Medicago truncatula RepID=G7KAK9_MEDTR SoyBaseE_val: 3.00E-22ISS
UniRef100_I1JWQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWQ7_SOYBN SoyBaseE_val: 1.00E-36ISS

Expression Patterns of Glyma02g34544
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g34544 not represented in the dataset
Glyma02g34544 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g34544 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g34544
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g34544
>Glyma02g34544.1   sequence type=CDS   gene model=Glyma02g34544   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATACCCGAGCTATTCAAGACATTTCCAAATGCAACAAAGTATCTCAAGACAATTGTAAGCTTCGGAAAGGTTAACCCTATACAAAAGCAAGAAGTTGAAAGTTTTGGGTTGGCAATATATTCATGGGATGAATTTTTACTAGTGGATGTCAAATTGTTAATTGATGATGTTGGGGAACTAAAACCAACTATTTTCTGTGTTGTTCCCCATGTGCTTGATAGAGTGTACTCAGGTTTGACACAGAAGATTTCTTCTGGGGGCTTCTTGAAGAAGACATTATTCAACTTTGCTTATTCATAG
Predicted protein sequences of Glyma02g34544
>Glyma02g34544.1   sequence type=predicted peptide   gene model=Glyma02g34544   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIPELFKTFPNATKYLKTIVSFGKVNPIQKQEVESFGLAIYSWDEFLLVDVKLLIDDVGELKPTIFCVVPHVLDRVYSGLTQKISSGGFLKKTLFNFAYS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo