|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G11030 | AT | Annotation by Michelle Graham. TAIR10: AMP-dependent synthetase and ligase family protein | chr4:6738120-6742229 FORWARD LENGTH=666 | SoyBase | E_val: 1.00E-18 | ISS |
| GO:0001676 | GO-bp | Annotation by Michelle Graham. GO Biological Process: long-chain fatty acid metabolic process | SoyBase | N/A | ISS |
| GO:0002213 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to insect | SoyBase | N/A | ISS |
| GO:0006631 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process | SoyBase | N/A | ISS |
| GO:0006633 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004467 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: long-chain fatty acid-CoA ligase activity | SoyBase | N/A | ISS |
| UniRef100_G7KAK9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Annotation was added to scaffolds in November 2011 Long-chain-fatty-acid-CoA ligase n=1 Tax=Medicago truncatula RepID=G7KAK9_MEDTR | SoyBase | E_val: 3.00E-22 | ISS |
| UniRef100_I1JWQ7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWQ7_SOYBN | SoyBase | E_val: 1.00E-36 | ISS |
|
Glyma02g34544 not represented in the dataset |
Glyma02g34544 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g34544.1 sequence type=CDS gene model=Glyma02g34544 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATACCCGAGCTATTCAAGACATTTCCAAATGCAACAAAGTATCTCAAGACAATTGTAAGCTTCGGAAAGGTTAACCCTATACAAAAGCAAGAAGTTGAAAGTTTTGGGTTGGCAATATATTCATGGGATGAATTTTTACTAGTGGATGTCAAATTGTTAATTGATGATGTTGGGGAACTAAAACCAACTATTTTCTGTGTTGTTCCCCATGTGCTTGATAGAGTGTACTCAGGTTTGACACAGAAGATTTCTTCTGGGGGCTTCTTGAAGAAGACATTATTCAACTTTGCTTATTCATAG
>Glyma02g34544.1 sequence type=predicted peptide gene model=Glyma02g34544 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIPELFKTFPNATKYLKTIVSFGKVNPIQKQEVESFGLAIYSWDEFLLVDVKLLIDDVGELKPTIFCVVPHVLDRVYSGLTQKISSGGFLKKTLFNFAYS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||