SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g34526

Feature Type:gene_model
Chromosome:Gm02
Start:38748141
stop:38748800
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g34526
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77380AT Annotation by Michelle Graham. TAIR10: amino acid permease 3 | chr1:29075201-29077252 REVERSE LENGTH=476 SoyBaseE_val: 5.00E-52ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_I1JZ24UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZ24_SOYBN SoyBaseE_val: 9.00E-63ISS
UniRef100_Q9SEW6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Amino acid transporter b (Fragment) n=1 Tax=Vicia faba RepID=Q9SEW6_VICFA SoyBaseE_val: 3.00E-57ISS

Expression Patterns of Glyma02g34526
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g34526 not represented in the dataset
Glyma02g34526 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g34526 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g190100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g34526
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g34526
>Glyma02g34526.1   sequence type=CDS   gene model=Glyma02g34526   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCAGTAACATGTACATGATTTCATTTGGTATAGTGGAAATTATTTTCTCACAAATTCCGGGCTTCGATCAATTGTGGTGGCTCTCCATTGTAGTTGCTGTCATGTCCTTCACATACTCCACTATTGGGCTAGGCCTTGGTATTGGAAAAGTTATTGAAAATAGAGGAGTCAGGGGAAGCCTAACCGAGATAACAATTGGTACCGTGACACAAACTAAAAAAGTTTGGAGAACCATGCAAGCTCTTGGTGACATAGCCTTTGCCTATTCATACTCCCTCATCCTTGTAGAAATTCAGGACACAGTGAAATCCCCTCCATCAGAGTAA
Predicted protein sequences of Glyma02g34526
>Glyma02g34526.1   sequence type=predicted peptide   gene model=Glyma02g34526   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSNMYMISFGIVEIIFSQIPGFDQLWWLSIVVAVMSFTYSTIGLGLGIGKVIENRGVRGSLTEITIGTVTQTKKVWRTMQALGDIAFAYSYSLILVEIQDTVKSPPSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo