SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g34201

Feature Type:gene_model
Chromosome:Gm02
Start:38379272
stop:38380925
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g34201
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52820AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr1:19669216-19670321 FORWARD LENGTH=317 SoyBaseE_val: 4.00E-44ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
UniRef100_B9GL08UniRef Annotation by Michelle Graham. Most informative UniRef hit: 2-oxoglutarate-dependent dioxygenase n=1 Tax=Populus trichocarpa RepID=B9GL08_POPTR SoyBaseE_val: 1.00E-46ISS
UniRef100_I1KH56UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KH56_SOYBN SoyBaseE_val: 2.00E-72ISS

Expression Patterns of Glyma02g34201
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g34201 not represented in the dataset
Glyma02g34201 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g34201 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g189200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g34201
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g34201
>Glyma02g34201.1   sequence type=CDS   gene model=Glyma02g34201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAAAACAGAATTTAAACTTCCAACTCGGACATTTGTCTGGAACCTCAAATTGGAAGCCAACAATCCTAATTGGGAGGCAATAAAATCCCAAGTCCACAAGGCACTAGTAGATTATGGTTGCTTTGAAGCAATTTTTGAAAAAGTTCCTTTAGAACTTCGCAAAGCCATATTTGCTGCACTACAAGAGCTCTTTGATCTCCCTCTACAAACAAAGATACTCAATGTGTCTAAGAAGCCTTATCATGGTTATGTTGGGCAAGCCAATATGGTCCCACTTTTTGAAAGTATGGGCATTGATGATGCAAATGTCTATGAAAATGTAGAAAGCATGACAAACATCATGTGGCCTCATGGAAACCCAAGTTTCAGGCATGTACCTATTAAAATTTAA
Predicted protein sequences of Glyma02g34201
>Glyma02g34201.1   sequence type=predicted peptide   gene model=Glyma02g34201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKTEFKLPTRTFVWNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFAALQELFDLPLQTKILNVSKKPYHGYVGQANMVPLFESMGIDDANVYENVESMTNIMWPHGNPSFRHVPIKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo