SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g34160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g34160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g34160

Feature Type:gene_model
Chromosome:Gm02
Start:38367024
stop:38367856
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48670AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 80 | chr5:19738825-19739790 REVERSE LENGTH=321 SoyBaseE_val: 4.00E-35ISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0043078GO-cc Annotation by Michelle Graham. GO Cellular Compartment: polar nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF69Panther AGL80/FEM111 (AGAMOUS-LIKE80), DNA BINDING / TRANS JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
UniRef100_G7J8R0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Agamous-like MADS-box protein AGL80 n=1 Tax=Medicago truncatula RepID=G7J8R0_MEDTR SoyBaseE_val: 8.00E-38ISS
UniRef100_UPI000233A352UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A352 related cluster n=1 Tax=unknown RepID=UPI000233A352 SoyBaseE_val: 4.00E-94ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g34160 not represented in the dataset

Glyma02g34160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g188900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g34160.2   sequence type=CDS   gene model=Glyma02g34160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGAAAGAAGGTTGATCTTGCATACATAAGCAATCCCAAGAAGAGGAAGGAAGTATTGAAGAAAAGGAAAAATGGTTTGCTAAAAAAGGTTGATGAAATCACTACCCTTTGTGGCATTGAGGCTTGTGCTATCATTTATAGTCCAGACGAACCTGAGCCTCAGGTTTGGTCATCTGACCAAGGAGTGGAAAGTGTGATTTTCAAGTTTAGGGGAGTTTCTGAATTGACACGAAACAAAAGAATGTTTTGTCAAGAGTCACTTTTAAGGAAAAACATAATCCAAGTGCAAGGGCAGCTCAAGAAACTCAGGAATGAAAATAGGATGAAGGAGATTAACCTTTTCATGTGTCAATACTTTGTTGGTGGTAACCACCTTGACAAGTCCAATATTATTGATCTGAATGATATCACATTCTTGGCTGATAAAAAGTTGGAGGAGATTACAAAGAAAATAGAAATGCTCCATGTCCAAGAGGTGACACCAACTACTGAAAATGAGGAGAAACCATGA

>Glyma02g34160.2   sequence type=predicted peptide   gene model=Glyma02g34160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARKKVDLAYISNPKKRKEVLKKRKNGLLKKVDEITTLCGIEACAIIYSPDEPEPQVWSSDQGVESVIFKFRGVSELTRNKRMFCQESLLRKNIIQVQGQLKKLRNENRMKEINLFMCQYFVGGNHLDKSNIIDLNDITFLADKKLEEITKKIEMLHVQEVTPTTENEEKP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo