Glyma02g34030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g34030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g34030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g34030

Feature Type:	gene_model
Chromosome:	Gm02
Start:	38039635
stop:	38040420
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g34030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02760	AT	Annotation by Michelle Graham. TAIR10: Class II aaRS and biotin synthetases superfamily protein \| chr3:597588-600650 REVERSE LENGTH=883	SoyBase	E_val: 1.00E-17	ISS
GO:0006418	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation	SoyBase	N/A	ISS
GO:0006427	GO-bp	Annotation by Michelle Graham. GO Biological Process: histidyl-tRNA aminoacylation	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0004812	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity	SoyBase	N/A	ISS
GO:0004821	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histidine-tRNA ligase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR11476	Panther	HISTIDYL-TRNA SYNTHETASE	JGI		ISS
UniRef100_Q45NM7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histidyl-tRNA synthetase (Fragment) n=1 Tax=Medicago sativa RepID=Q45NM7_MEDSA	SoyBase	E_val: 9.00E-20	ISS
UniRef100_Q45NM7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Histidyl-tRNA synthetase (Fragment) n=1 Tax=Medicago sativa RepID=Q45NM7_MEDSA	SoyBase	E_val: 9.00E-20	ISS

Expression Patterns of Glyma02g34030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g34030 not represented in the dataset	Glyma02g34030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g34030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g188100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g34030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g34030

Limit To All Plant Sequences

>Glyma02g34030.1   sequence type=CDS   gene model=Glyma02g34030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAATGTTTTCTTTTACACATCCATTCATTTTGTATTTAGAAATTACTGGTAAAAAAATGTCTGAGCTTTATGTGTTGGAGTTGGGGACAAAAGGTTGTGCTGAAGTTACTATCTTCAAAACTACTCTTGTTTTATTGTATAGAAAGTTAAATCAATCATTTTATTATGACAGTCACATTTTTGCATACACCCTGTTCTTTCTATGTTTCATTTACGTTGTTGGTTCAATTGCTGCTGGTGGCCGATATGATAACCTTATAGGGATGTTTGGCTCAAGGTCAGTGCCTGCAGTTGGTGTAAGTCTGGGAATTGAAAGAGTATTTGCCATAATGGAGCAACAATAG

Predicted protein sequences of Glyma02g34030

Limit To All Plant Sequences

>Glyma02g34030.1   sequence type=predicted peptide   gene model=Glyma02g34030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KMFSFTHPFILYLEITGKKMSELYVLELGTKGCAEVTIFKTTLVLLYRKLNQSFYYDSHIFAYTLFFLCFIYVVGSIAAGGRYDNLIGMFGSRSVPAVGVSLGIERVFAIMEQQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain