SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g33940

Feature Type:gene_model
Chromosome:Gm02
Start:37953033
stop:37953517
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g33940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31310AT Annotation by Michelle Graham. TAIR10: AIG2-like (avirulence induced gene) family protein | chr4:15191325-15192337 FORWARD LENGTH=172 SoyBaseE_val: 2.00E-28ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
PF06094PFAM AIG2-like family JGI ISS
UniRef100_A2RVS4UniRef Annotation by Michelle Graham. Most informative UniRef hit: AIG2-like protein n=1 Tax=Arabidopsis thaliana RepID=A2RVS4_ARATH SoyBaseE_val: 1.00E-25ISS
UniRef100_UPI0002336F07UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336F07 related cluster n=1 Tax=unknown RepID=UPI0002336F07 SoyBaseE_val: 1.00E-50ISS

Expression Patterns of Glyma02g33940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g33940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g33940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g33940
>Glyma02g33940.1   sequence type=CDS   gene model=Glyma02g33940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTAAGAGCAAAGGTCGCATTTATCCCGTTATTCTCCCCGTCCAAAACAACAAAGTTAATGGCAGGGTCTTGCTTCTTGGTATCTCCGGAGTAGAACTAGATATCTTAGATGAGTTCAAGGATGTTGAATATACTAGAACTGATGTTGAGGTTTCCTTGAAGGACAAGTCTGAAAGGTTACAAGTTTGCGCTTATGTTTGGAGCAACCCAAATGATCCTAACTTATATGCAGAGTGGGATTTTGAG
Predicted protein sequences of Glyma02g33940
>Glyma02g33940.1   sequence type=predicted peptide   gene model=Glyma02g33940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FKSKGRIYPVILPVQNNKVNGRVLLLGISGVELDILDEFKDVEYTRTDVEVSLKDKSERLQVCAYVWSNPNDPNLYAEWDFE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo