|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G43690 | AT | Annotation by Michelle Graham. TAIR10: ubiquitin interaction motif-containing protein | chr1:16478519-16482589 FORWARD LENGTH=599 | SoyBase | E_val: 2.00E-23 | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
GO:0016926 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein desumoylation | SoyBase | N/A | ISS |
GO:0050665 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
UniRef100_G7J147 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: FAM188A-like protein (Fragment) n=1 Tax=Medicago truncatula RepID=G7J147_MEDTR | SoyBase | E_val: 3.00E-45 | ISS |
UniRef100_I1LDH0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDH0_SOYBN | SoyBase | E_val: 4.00E-54 | ISS |
Glyma02g33876 not represented in the dataset |
Glyma02g33876 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.02g187700 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g33876.1 sequence type=CDS gene model=Glyma02g33876 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGCGAAATTTTATTTTCATGTGGAAGTAATAGAAGGGCTGTGATTGCAACTTTGAGCATTCCCGAAAATGACATTCAGCGTTTTGAAGGGATTTCAGAAGTTGAGGTTGTTACAAAATCACTTCAAGGTCTTTCCATTGAATCTGCCTTGGATCTGCAAAAACTTCTTAGAGTTGAAACATGCACATCACAAACAACTGCTTTGCAAAGGCTTGAAGCAAATCTTCCCCTTTTCCAAAGTCGAATGGGAGCATTGCTTTTCCTAATCTCTGCTTTACTTTCTCGAGGACTGGTATGTTTGGCTGCTTCAAGCTCTGCTATTTACTTCAGTTGCATTTTACAGTCTCTGAATTCACTGTCTTTCAAAGCAAGAGATATTGGGCTATTTCTTTCCCTCTATTTTCTTTTGCTGAAAATATGTTAA
>Glyma02g33876.1 sequence type=predicted peptide gene model=Glyma02g33876 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGEILFSCGSNRRAVIATLSIPENDIQRFEGISEVEVVTKSLQGLSIESALDLQKLLRVETCTSQTTALQRLEANLPLFQSRMGALLFLISALLSRGLVCLAASSSAIYFSCILQSLNSLSFKARDIGLFLSLYFLLLKIC*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||