SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g33876

Feature Type:gene_model
Chromosome:Gm02
Start:37802632
stop:37803215
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G43690AT Annotation by Michelle Graham. TAIR10: ubiquitin interaction motif-containing protein | chr1:16478519-16482589 FORWARD LENGTH=599 SoyBaseE_val: 2.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7J147UniRef Annotation by Michelle Graham. Most informative UniRef hit: FAM188A-like protein (Fragment) n=1 Tax=Medicago truncatula RepID=G7J147_MEDTR SoyBaseE_val: 3.00E-45ISS
UniRef100_I1LDH0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDH0_SOYBN SoyBaseE_val: 4.00E-54ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g33876 not represented in the dataset

Glyma02g33876 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g187700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g33876.1   sequence type=CDS   gene model=Glyma02g33876   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCGAAATTTTATTTTCATGTGGAAGTAATAGAAGGGCTGTGATTGCAACTTTGAGCATTCCCGAAAATGACATTCAGCGTTTTGAAGGGATTTCAGAAGTTGAGGTTGTTACAAAATCACTTCAAGGTCTTTCCATTGAATCTGCCTTGGATCTGCAAAAACTTCTTAGAGTTGAAACATGCACATCACAAACAACTGCTTTGCAAAGGCTTGAAGCAAATCTTCCCCTTTTCCAAAGTCGAATGGGAGCATTGCTTTTCCTAATCTCTGCTTTACTTTCTCGAGGACTGGTATGTTTGGCTGCTTCAAGCTCTGCTATTTACTTCAGTTGCATTTTACAGTCTCTGAATTCACTGTCTTTCAAAGCAAGAGATATTGGGCTATTTCTTTCCCTCTATTTTCTTTTGCTGAAAATATGTTAA

>Glyma02g33876.1   sequence type=predicted peptide   gene model=Glyma02g33876   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEILFSCGSNRRAVIATLSIPENDIQRFEGISEVEVVTKSLQGLSIESALDLQKLLRVETCTSQTTALQRLEANLPLFQSRMGALLFLISALLSRGLVCLAASSSAIYFSCILQSLNSLSFKARDIGLFLSLYFLLLKIC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo