Glyma02g33660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g33660

Feature Type:	gene_model
Chromosome:	Gm02
Start:	37426995
stop:	37430749
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g33660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G04170	AT	Annotation by Michelle Graham. TAIR10: Calcium-binding EF-hand family protein \| chr5:1145579-1147519 FORWARD LENGTH=354	SoyBase	E_val: 1.00E-46	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0030048	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament-based movement	SoyBase	N/A	ISS
GO:0051645	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi localization	SoyBase	N/A	ISS
GO:0051646	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrion localization	SoyBase	N/A	ISS
GO:0060151	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome localization	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
KOG0037	KOG	Ca2+-binding protein, EF-Hand protein superfamily	JGI		ISS
PTHR10183	Panther	CALPAIN	JGI		ISS
PTHR10183:SF16	Panther	CALPAIN-RELATED	JGI		ISS
PF00036	PFAM	EF hand	JGI		ISS
UniRef100_E2JF17	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: EF-hand calcium-binding protein n=1 Tax=Vitis vinifera RepID=E2JF17_VITVI	SoyBase	E_val: 6.00E-54	ISS
UniRef100_I1LA46	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LA46_SOYBN	SoyBase	E_val: 2.00E-71	ISS

Expression Patterns of Glyma02g33660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g33660 not represented in the dataset	Glyma02g33660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g33660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g186900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g33660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g33660

Limit To All Plant Sequences

>Glyma02g33660.1   sequence type=CDS   gene model=Glyma02g33660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCGGCTACCCCAACCAGCCTCCCAGCTACGGCTACGGCTACGGCGCGCCGCCGCCGCCCCATCCCTACGGCGCTCCTCAGCCCCCGCAATCCTACGGCGCGCCGCCGCCCGCTCAGCCATACTCCGCCGCGCCCTACGCCCAGCCGTCCGCCCCCTACAATAAACCTCCGAAGAACGAGTCCCACTCCCACAGCGGCGGAAGCGGCGGATCCACTCTATACGGTGGTTTTATTACTTCCACGTGGCCTCGGAAGTTACTCAAAATCCATGAAACCAAACATGTGAAAATATATCCAAAATTCATGCTGGACTCAGAATCAATTTCCGAACGCCAAATCAAACACGCCCTAACTTGGTTATTATTGTTGCAGTCCATTTTTGAGAGATTTGACAAGGACAGAAGCGGCAAAATCGATTATACTGAGTTGAGAGATGCTCTACTGAGTCTGGGTTATGCTGTTTCTCCAGTGGTATTGGATTTGCTCGTCTCCAAGTTTGACAAAACTGGTGGAAAAAGCAAGGCTATAGAATATGATAATTTCATCGAGTATGGCTTTTCTTCAATTCGTTATTTAAAACGGGAGAAACTCTCAATAAAATTGAAATTTTCTCTTTTCATTAGCATTATGTTTACCTTTACTTTCCTGGGACTAACTGACAAATTCAAGGAGAAGGATACTGCGTATTCTGGGTCTGCAACCTTCTCCTATGAATCGTTTATGCTGACAGTCCTGCCATTCCTAATAGCTTAG

Predicted protein sequences of Glyma02g33660

Limit To All Plant Sequences

>Glyma02g33660.1   sequence type=predicted peptide   gene model=Glyma02g33660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGYPNQPPSYGYGYGAPPPPHPYGAPQPPQSYGAPPPAQPYSAAPYAQPSAPYNKPPKNESHSHSGGSGGSTLYGGFITSTWPRKLLKIHETKHVKIYPKFMLDSESISERQIKHALTWLLLLQSIFERFDKDRSGKIDYTELRDALLSLGYAVSPVVLDLLVSKFDKTGGKSKAIEYDNFIEYGFSSIRYLKREKLSIKLKFSLFISIMFTFTFLGLTDKFKEKDTAYSGSATFSYESFMLTVLPFLIA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain