Glyma02g33320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g33320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g33320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g33320

Feature Type:	gene_model
Chromosome:	Gm02
Start:	37079307
stop:	37083261
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g33320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G28900	AT	Annotation by Michelle Graham. TAIR10: outer plastid envelope protein 16-1 \| chr2:12414423-12415459 REVERSE LENGTH=148	SoyBase	E_val: 3.00E-60	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009749	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0045037	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009527	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid outer membrane	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009707	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast outer membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0015171	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015450	GO-mf	Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity	SoyBase	N/A	ISS
PF02466	PFAM	Tim17/Tim22/Tim23 family	JGI		ISS
UniRef100_C6TFJ4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TFJ4_SOYBN	SoyBase	E_val: 8.00E-100	ISS
UniRef100_Q5CZ54	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pom14 protein n=1 Tax=Solanum tuberosum RepID=Q5CZ54_SOLTU	SoyBase	E_val: 1.00E-69	ISS

Expression Patterns of Glyma02g33320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g33320 not represented in the dataset	Glyma02g33320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g33320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g184800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g33320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma02g33320

Limit To All Plant Sequences

>Glyma02g33320.2   sequence type=transcript   gene model=Glyma02g33320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTAAATGAAGCAAGCATTCATAAAGCATAACTGAAGAAAACTAAGGAAGGAAGGAAGGAAGGAAGAGTGAGCGTGAAAGATGCCTTCGGCGAGGCTTTCAGGGTCACCAAGGCTCGACGTTGCTATTGACATGGGCAATCCATTTCTCAATCTCACTGTTGATGGTTTCCTTAAGATCGGAGCTGTCGCAGCCACGCGATCAGCTGCTGAAGATACTTATCATATTATCCGAAACGGGAATATCTCAAGTCATGATTTCGAGAAAACGTTGAAGAAGATGTGTAAAGAAGGTGTATATTGGGGAACTTTAGCTGGTGTTTATCTTGGAATGGAATATGGGGTAGAGAGGATCCGTGGCACCAGAGATTGGGTAATCCTCTCCATAGGAAGAATGCCATGATTGGGGGTGCAGTAACTGCGACTCTGTTATCTGTTGCCACCACCAACAACAAAGACAAAATTGTACCTGATGCCATTACTGGGGCAGCAATTGCTACTGCTGCAGAGTTCATAAATTACCTTACCTGAATGAATGAAAGTGGATGTCTTGCTGGTTTTCTTGCATGTTTTGGAAAGGGATTGCAACTCAGTCTCTTTTGTCATATACTTTGTAACGGTTCCATCTTGATATTGGTGCAGTTACTTCTAAGATATGCTATTTATTTAACTTTCTATAAAACCTATGTTTTGATAAATTATATTGGCCAATGGTTTTTCCGCATGTT

Coding sequences of Glyma02g33320

Limit To All Plant Sequences

>Glyma02g33320.1   sequence type=CDS   gene model=Glyma02g33320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTCGGCGAGGCTTTCAGGGTCACCAAGGCTCGACGTTGCTATTGACATGGGCAATCCATTTCTCAATCTCACTGTTGATGGTTTCCTTAAGATCGGAGCTGTCGCAGCCACGCGATCAGCTGCTGAAGATACTTATCATATTATCCGAAACGGGAATATCTCAAGTCATGATTTCGAGAAAACGTTGAAGAAGATGTGTAAAGAAGGTGTATATTGGGGAACTTTAGCTGGTGTTTATCTTGGAATGGAATATGGGGTAGAGAGGATCCGTGGCACCAGAGATTGGAAGAATGCCATGATTGGGGGTGCAGTAACTGCGACTCTGTTATCTGTTGCCACCACCAACAACAAAGACAAAATTGTACCTGATGCCATTACTGGGGCAGCAATTGCTACTGCTGCAGAGTTCATAAATTACCTTACCTGA

>Glyma02g33320.2   sequence type=CDS   gene model=Glyma02g33320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTCGGCGAGGCTTTCAGGGTCACCAAGGCTCGACGTTGCTATTGACATGGGCAATCCATTTCTCAATCTCACTGTTGATGGTTTCCTTAAGATCGGAGCTGTCGCAGCCACGCGATCAGCTGCTGAAGATACTTATCATATTATCCGAAACGGGAATATCTCAAGTCATGATTTCGAGAAAACGTTGAAGAAGATGTGTAAAGAAGGTGTATATTGGGGAACTTTAGCTGGTGTTTATCTTGGAATGGAATATGGGGTAGAGAGGATCCGTGGCACCAGAGATTGGGTAATCCTCTCCATAGGAAGAATGCCATGA

Predicted protein sequences of Glyma02g33320

Limit To All Plant Sequences

>Glyma02g33320.1   sequence type=predicted peptide   gene model=Glyma02g33320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSARLSGSPRLDVAIDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHIIRNGNISSHDFEKTLKKMCKEGVYWGTLAGVYLGMEYGVERIRGTRDWKNAMIGGAVTATLLSVATTNNKDKIVPDAITGAAIATAAEFINYLT*

>Glyma02g33320.2   sequence type=predicted peptide   gene model=Glyma02g33320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSARLSGSPRLDVAIDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHIIRNGNISSHDFEKTLKKMCKEGVYWGTLAGVYLGMEYGVERIRGTRDWVILSIGRMP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain