SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g33040

Feature Type:gene_model
Chromosome:Gm02
Start:36598807
stop:36603880
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g33040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57390AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 18 | chr3:21233910-21235735 FORWARD LENGTH=256 SoyBaseE_val: 4.00E-66ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048577GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of short-day photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_E6NU98UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL06B08.10 protein n=1 Tax=Jatropha curcas RepID=E6NU98_9ROSI SoyBaseE_val: 2.00E-93ISS
UniRef100_I1JGA3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JGA3_SOYBN SoyBaseE_val: 2.00E-172ISS

Expression Patterns of Glyma02g33040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g33040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g185500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g33040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g33040
>Glyma02g33040.1   sequence type=CDS   gene model=Glyma02g33040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAGAGGGAAGATTGAGATTAAGAAGATTGAGAATTTGAACAGCAGACAAGTTACCTTCTCCAAGAGGAGAAATGGGTTGTTGAAGAAGGCCAAAGAGTTGTCTGTTCTCTGTGATGCAGAGGTTGCTGTCATCATATTCTCCAGCACTGGCAAGCTTTATGAGTTCTCAAACACAAGCATGGAGCATACCCTTTCGAGGTACAGTAAAGGCGCAGAATCAGATTCTGCAGAGCAACCTATTGATGTGCCCCCAACAGATGTTATGGCTGTGGAGCCTGATACTAACCTTTTGATGGAGGAAATAACAAAGCTTCGATCAGCATACTTAAGGATGATGGGTAAGGAGCTTGATGGATTGAGCCTTAAAGAACTGCAACAACTAGAAAATCAACTAAGTGAAGGGATGCAATCTGTCAAAGACAAGAAGGAACAAGTACTTGTGGAACAGCTTAGGAAGTCCAGGATACAGGAGCAAAAGGCCATGCTGGAAAATGAAGTTCTGCGCAAACAGCTTGAGGAAATACAAAATAAAACAAAGTCACAGTTCCTTGAATTCAGCTCTTTGGATAGGACATTTTCCAAGAATGGTTCAAAATCCCTTTTCAATTGTGCTTCAGAGGAAAATGACCTTTCAGATACTTCCTTGCAGTTAGGGTTGTCAACAGATTATGGTCGCCAGAGGAAAGCATTGAAGATGGAACCTTGCAACGACTCAGGGAGTCAAGTGGCTTCACATTGA
Predicted protein sequences of Glyma02g33040
>Glyma02g33040.1   sequence type=predicted peptide   gene model=Glyma02g33040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIIFSSTGKLYEFSNTSMEHTLSRYSKGAESDSAEQPIDVPPTDVMAVEPDTNLLMEEITKLRSAYLRMMGKELDGLSLKELQQLENQLSEGMQSVKDKKEQVLVEQLRKSRIQEQKAMLENEVLRKQLEEIQNKTKSQFLEFSSLDRTFSKNGSKSLFNCASEENDLSDTSLQLGLSTDYGRQRKALKMEPCNDSGSQVASH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo