SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g31941

Feature Type:gene_model
Chromosome:Gm02
Start:35118495
stop:35119889
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g31941
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21160AT Annotation by Michelle Graham. TAIR10: Calcium-dependent ARF-type GTPase activating protein family | chr4:11284694-11286532 FORWARD LENGTH=337 SoyBaseE_val: 9.00E-53ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0016197GO-bp Annotation by Michelle Graham. GO Biological Process: endosomal transport SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005543GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR23180Panther CENTAURIN/ARF JGI ISS
PTHR23180:SF24Panther CENTAURIN/ARF-RELATED JGI ISS
PF01412PFAM Putative GTPase activating protein for Arf JGI ISS
UniRef100_G7IKU9UniRef Annotation by Michelle Graham. Most informative UniRef hit: ZAC n=2 Tax=Medicago truncatula RepID=G7IKU9_MEDTR SoyBaseE_val: 5.00E-54ISS
UniRef100_UPI000233EEEDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EEED related cluster n=1 Tax=unknown RepID=UPI000233EEED SoyBaseE_val: 1.00E-62ISS

Expression Patterns of Glyma02g31941
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g31941 not represented in the dataset
Glyma02g31941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g31941 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g183900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g31941
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g31941
>Glyma02g31941.1   sequence type=CDS   gene model=Glyma02g31941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGGCAAGTGTCTTATAGGTAAAACAAAAGTAAAGGATTTATTGCTTCAAAAAGATAATCGCTTTTGTGTTGATTGCAATGCTCCAAATCCTAAATGGGTGTCAGCCAATATTGGAGTTTCTGTATGCTTAAAATGTTGTGGTGTGCACAGAAGTATTGGTTCTCAGATATCAAAGGTTTTGTTTGTGACATTGGATGAATGGTCAAGTGATGAAATAGATGCAATGATTGAAGTTGGAGGAAATTCTTCTGCTAATTACATTTATGAGGCTTATTTTCCCAAAGGATATACAAAACCTGGACCGGATGCCAGTCATAAGCAGTGA
Predicted protein sequences of Glyma02g31941
>Glyma02g31941.1   sequence type=predicted peptide   gene model=Glyma02g31941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIGKCLIGKTKVKDLLLQKDNRFCVDCNAPNPKWVSANIGVSVCLKCCGVHRSIGSQISKVLFVTLDEWSSDEIDAMIEVGGNSSANYIYEAYFPKGYTKPGPDASHKQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo