Glyma02g31910 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g31910

Feature Type:	gene_model
Chromosome:	Gm02
Start:	35092068
stop:	35093234
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g31910

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G24900	AT	Annotation by Michelle Graham. TAIR10: cytochrome P450, family 714, subfamily A, polypeptide 2 \| chr5:8563853-8566771 REVERSE LENGTH=525	SoyBase	E_val: 7.00E-12	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016705	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	SoyBase	N/A	ISS
GO:0019825	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxygen binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
UniRef100_B9N1R4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Populus trichocarpa RepID=B9N1R4_POPTR	SoyBase	E_val: 4.00E-13	ISS
UniRef100_I1N3C7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3C7_SOYBN	SoyBase	E_val: 4.00E-24	ISS

Expression Patterns of Glyma02g31910

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g31910 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g183800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g31910

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g31910

Limit To All Plant Sequences

>Glyma02g31910.1   sequence type=CDS   gene model=Glyma02g31910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACAAGTCCTTGCACCTAGGCCGGCCATCGTATCTAACCAAAACATTGAAGCCTTTGCTGGGGAATGGCATCATTAGGTCTAATGGACTGCAGTGGGCATTCCCAAGGAATCTACTTGCTCCTGAGTTTTTTCATAGCAAAATTAAGTAG

Predicted protein sequences of Glyma02g31910

Limit To All Plant Sequences

>Glyma02g31910.1   sequence type=predicted peptide   gene model=Glyma02g31910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHKSLHLGRPSYLTKTLKPLLGNGIIRSNGLQWAFPRNLLAPEFFHSKIK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain