SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g31243): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g31243): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g31243

Feature Type:gene_model
Chromosome:Gm02
Start:33984372
stop:33984972
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g31243
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08290AT Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein | chr4:5239088-5240398 FORWARD LENGTH=282 SoyBaseE_val: 1.00E-36ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF00892PFAM EamA-like transporter family JGI ISS
UniRef100_G7J315UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7J315_MEDTR SoyBaseE_val: 1.00E-59ISS
UniRef100_UPI0002336DF4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336DF4 related cluster n=1 Tax=unknown RepID=UPI0002336DF4 SoyBaseE_val: 4.00E-76ISS

Expression Patterns of Glyma02g31243
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g31243 not represented in the dataset
Glyma02g31243 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g31243 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g181000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g31243
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g31243
>Glyma02g31243.1   sequence type=CDS   gene model=Glyma02g31243   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCACAAATGCAAGGCCGTATCTGCTGTTAGTGGCAGTTCAATTTGGGTCTGCTGGCATGTTCATATTTGCGATGGATTCTATAAAGAAGGGTATGAGCCATTACGTGTTCATCGTCTATCGTAATGCCATCGCCTCTGTATCTCTTGCTCCCTTCGCATTTGTTCTTGAAAGGAAAGTTAGGCCCAAGATGACTTTCCGGGTATTTTCAGAGATTATGGCACTGGCTTTCTTCGAAATAATGCTGGACCAGTGCATCGCCCTCTTGGGCATGAAATTCGCGTCGGCATCTTTCCTATCTGTTGTTATGAACTCCGCTCACTCTGTTACTTTTGTGATGTCTGTCATTCTAAGGTAA
Predicted protein sequences of Glyma02g31243
>Glyma02g31243.1   sequence type=predicted peptide   gene model=Glyma02g31243   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFTNARPYLLLVAVQFGSAGMFIFAMDSIKKGMSHYVFIVYRNAIASVSLAPFAFVLERKVRPKMTFRVFSEIMALAFFEIMLDQCIALLGMKFASASFLSVVMNSAHSVTFVMSVILR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo