|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G04730 | AT | Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr1:1325385-1331086 REVERSE LENGTH=943 | SoyBase | E_val: 3.00E-52 | ISS |
| GO:0006261 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication | SoyBase | N/A | ISS |
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005657 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: replication fork | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| UniRef100_G7ZZN4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chromosome transmission fidelity protein-like protein n=1 Tax=Medicago truncatula RepID=G7ZZN4_MEDTR | SoyBase | E_val: 9.00E-65 | ISS |
| UniRef100_I1NEG6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NEG6_SOYBN | SoyBase | E_val: 2.00E-84 | ISS |
|
Glyma02g31173 not represented in the dataset |
Glyma02g31173 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g31173.1 sequence type=CDS gene model=Glyma02g31173 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAAGAAAATCTCATAGAGGCAAGTCCTTTGAATTTGACTCCTTGTACTCCCTTGTTTCAAATCGTGGTGATAGTAACTTGATTCTGGATGGAATTCATGAAAATATTTTGCAGCTCAATTATCATGACGTAGTAATGCAGAAAACTGTCAAATGCTTTAACAATCTTGGGGTTTATGATCTAATGCATCAATATATAATGCATACACAACAGATGCCCCTGTATGTTCAAAAACCAAACATTAAGTGGCCAAAATCACATCAGAGATATCGTACCATGATGATGGAAAAGATGGACATTTTGAATACCTGGAACCACAAAATCCCATCGTATATTGCAAGGAACTTATTAGCTAGTTCCTTTGTTGTAACCTTAATTTCTCCATTATTACATATTTTGTCCCCACCAACTATAAGACCGGTAATGTACTAA
>Glyma02g31173.1 sequence type=predicted peptide gene model=Glyma02g31173 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MERKSHRGKSFEFDSLYSLVSNRGDSNLILDGIHENILQLNYHDVVMQKTVKCFNNLGVYDLMHQYIMHTQQMPLYVQKPNIKWPKSHQRYRTMMMEKMDILNTWNHKIPSYIARNLLASSFVVTLISPLLHILSPPTIRPVMY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||