Glyma02g30780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g30780

Feature Type:	gene_model
Chromosome:	Gm02
Start:	32906948
stop:	32907334
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g30780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G22580	AT	Annotation by Michelle Graham. TAIR10: Stress responsive A/B Barrel Domain \| chr5:7502709-7503137 FORWARD LENGTH=111	SoyBase	E_val: 3.00E-21	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07876	PFAM	Stress responsive A/B Barrel Domain	JGI		ISS
UniRef100_F0SN89	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Stress responsive alpha-beta barrel domain-containing protein n=1 Tax=Planctomyces brasiliensis DSM 5305 RepID=F0SN89_PLABD	SoyBase	E_val: 1.00E-07	ISS
UniRef100_I1JG48	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JG48_SOYBN	SoyBase	E_val: 7.00E-36	ISS

Expression Patterns of Glyma02g30780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g30780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g178000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g30780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g30780

Limit To All Plant Sequences

>Glyma02g30780.2   sequence type=CDS   gene model=Glyma02g30780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAATAGTACACACAATTCTCATGTACTTAACTATATATTTGTATGGTAGGGGAAAGGACATTGAAAGTCATGATATGCTAAGACAAGGTTTCACTCATGTTTTCTTGATGACATTCAATGGGAAGGACGAGTTCAACGCATTTCAGACTCAACCGAATCACTTTGAGTTTACTGGAGTATTTTCACCTGTTATTGAGAACATTGTGGTGCTGGATTTCCCATATAACCTTGTGAAAGCACCAGAATGA

Predicted protein sequences of Glyma02g30780

Limit To All Plant Sequences

>Glyma02g30780.2   sequence type=predicted peptide   gene model=Glyma02g30780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QIVHTILMYLTIYLYGRGKDIESHDMLRQGFTHVFLMTFNGKDEFNAFQTQPNHFEFTGVFSPVIENIVVLDFPYNLVKAPE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain