Glyma02g30758 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g30758): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g30758): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g30758

Feature Type:	gene_model
Chromosome:	Gm02
Start:	32874515
stop:	32875352
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g30758

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G04810	AT	Annotation by Michelle Graham. TAIR10: NIMA-related kinase 2 \| chr3:1318096-1321101 FORWARD LENGTH=606	SoyBase	E_val: 3.00E-20	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24362	Panther	SERINE/THREONINE-PROTEIN KINASE NEK	JGI		ISS
PTHR24362:SF158	Panther		JGI		ISS
UniRef100_G7KUE2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase Nek2 n=1 Tax=Medicago truncatula RepID=G7KUE2_MEDTR	SoyBase	E_val: 1.00E-19	ISS
UniRef100_UPI000233D6B3	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D6B3 related cluster n=1 Tax=unknown RepID=UPI000233D6B3	SoyBase	E_val: 1.00E-28	ISS

Expression Patterns of Glyma02g30758

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g30758 not represented in the dataset	Glyma02g30758 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g30758 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g177900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g30758

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g30758

Limit To All Plant Sequences

>Glyma02g30758.1   sequence type=CDS   gene model=Glyma02g30758   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCTAATAGCAAAACTACATTACCCATATATTGTGGAGTACAAAGATGCTTGGGTGGAGAAGGATGACTACATATGCATTATAACTGGCTATTGTGAAGGAGGAGACATGGCTGTGAATATAAAGAAAGCTTGGGGATCTTATTTTTCGGAGGAGGTAACTAATAAGGCTTTGTGTTCCATTCCTTGGTTACTCTTCCATTTTCGGGGATCTTATCAATAA

Predicted protein sequences of Glyma02g30758

Limit To All Plant Sequences

>Glyma02g30758.1   sequence type=predicted peptide   gene model=Glyma02g30758   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLIAKLHYPYIVEYKDAWVEKDDYICIITGYCEGGDMAVNIKKAWGSYFSEEVTNKALCSIPWLLFHFRGSYQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain