SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g30452

Feature Type:gene_model
Chromosome:Gm02
Start:32425623
stop:32428554
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g30452
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08300AT Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein | chr4:5245024-5248153 FORWARD LENGTH=373 SoyBaseE_val: 6.00E-31ISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF00892PFAM EamA-like transporter family JGI ISS
UniRef100_G7J315UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7J315_MEDTR SoyBaseE_val: 1.00E-48ISS
UniRef100_UPI0002336CD3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336CD3 related cluster n=1 Tax=unknown RepID=UPI0002336CD3 SoyBaseE_val: 7.00E-62ISS

Expression Patterns of Glyma02g30452
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g30452 not represented in the dataset
Glyma02g30452 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g30452 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g30452
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g30452
>Glyma02g30452.1   sequence type=CDS   gene model=Glyma02g30452   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCATATTTGCGATGGATTCTATAAAGAAGGGTATGAGCCATTACGTGTTCATCGTCTATCGTAATGCCATCGCCTCTGTATCTCTTGCTCCCTTCGCATTTGTTCTTGAAAGGAAAGTTAGGCCCAAGATGACTTTCCGGGTATTTTTAGAGATTATGGCACTGGCTTTCTTCGAAATAATGTTGGACCAGTGCATCGCCCTCTTGGGCATGAAATTCACGTCGGCATCTTTCCTATCTGCTGTTATGAACTCCGCTCACTCTGTTACTTTTGTGATGGCTGTCATTCTAAGGGTATAA
Predicted protein sequences of Glyma02g30452
>Glyma02g30452.1   sequence type=predicted peptide   gene model=Glyma02g30452   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFIFAMDSIKKGMSHYVFIVYRNAIASVSLAPFAFVLERKVRPKMTFRVFLEIMALAFFEIMLDQCIALLGMKFTSASFLSAVMNSAHSVTFVMAVILRV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo