SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g30066): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g30066): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g30066

Feature Type:gene_model
Chromosome:Gm02
Start:32123373
stop:32127846
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12150AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF2048 (InterPro:IPR019149); Has 421 Blast hits to 334 proteins in 155 species: Archae - 2; Bacteria - 147; Metazoa - 215; Fungi - 0; Plants - 43; Viruses - 0; Other Eukaryotes - 14 (source: NCBI BLink). | chr3:3876688-3878621 REVERSE LENGTH=363 SoyBaseE_val: 3.00E-91ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13617Panther FAMILY NOT NAMED JGI ISS
PTHR13617:SF1Panther gb def: agcp15537 [anopheles gambiae str. pest] JGI ISS
PF09752PFAM Uncharacterized conserved protein (DUF2048) JGI ISS
UniRef100_I0YLT0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alpha/beta-hydrolase (Fragment) n=1 Tax=Coccomyxa subellipsoidea C-169 RepID=I0YLT0_9CHLO SoyBaseE_val: 6.00E-43ISS
UniRef100_I1JG38UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JG38_SOYBN SoyBaseE_val: 9.00E-164ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g30066 not represented in the dataset

Glyma02g30066 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g176500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g30066.1   sequence type=CDS   gene model=Glyma02g30066   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAAGACATCCAATGCTGCAGCGTGGTGCAAAACTTTTGTGTTAGTGACTTGCTTCTATTAGGAAGAGCAACCATTGAAGAGTCACGTGGCCTTTTACACTGGATGTACTCTGAGGCAGGTTTTAGCAAGATGGGGATTTGTGGACTTAGTATGGGAGGAGTACATGCTGCAATGGTTGGATCACTTCACCCAACGCCTGTTGCAACCTTCCCTTTTCTGTCCCCACATTCTGCTGCTGTGGCATTCCGTGAGGGGATTTTGAAGTATGGAACTGCCTGGGAGGCACTGAGAGGGGATCTTGCAACTCAGAAGGCTGAAATGACTCTTGAGGAAGTGAGAGAGCGGCTACGAAATGTATTATCTCTAACAGAAGTGACATGTTTTCCAATTCCCAAAATCCCCAATGCTGTTATTTTTGTTTCTGCCACTGATGATGGATACATCCCGAAACACTCGGTCCTTGAACTTCAGAAAGCCTGGCCAGGTTCTGAGGTGAGATGGGTCACAGGTGGGCATGTCTCTTCTTTCTGCCCCATGGTGAATTCAGAAGGGCTATTGTTGAAGGCCTTAATTGATTACCGTGGAAGGAGTCTCCATTGTGACAGGGACATTGCACAGGCACAAGAGATTGTTTTGCAAATTGTGAAGATATTGTTTTTCCAATTGTAG

>Glyma02g30066.1   sequence type=predicted peptide   gene model=Glyma02g30066   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKDIQCCSVVQNFCVSDLLLLGRATIEESRGLLHWMYSEAGFSKMGICGLSMGGVHAAMVGSLHPTPVATFPFLSPHSAAVAFREGILKYGTAWEALRGDLATQKAEMTLEEVRERLRNVLSLTEVTCFPIPKIPNAVIFVSATDDGYIPKHSVLELQKAWPGSEVRWVTGGHVSSFCPMVNSEGLLLKALIDYRGRSLHCDRDIAQAQEIVLQIVKILFFQL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo