SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g30052

Feature Type:gene_model
Chromosome:Gm02
Start:32121734
stop:32121934
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g30052
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12150AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF2048 (InterPro:IPR019149); Has 421 Blast hits to 334 proteins in 155 species: Archae - 2; Bacteria - 147; Metazoa - 215; Fungi - 0; Plants - 43; Viruses - 0; Other Eukaryotes - 14 (source: NCBI BLink). | chr3:3876688-3878621 REVERSE LENGTH=363 SoyBaseE_val: 2.00E-18ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13617Panther FAMILY NOT NAMED JGI ISS
PTHR13617:SF1Panther gb def: agcp15537 [anopheles gambiae str. pest] JGI ISS
UniRef100_UPI000233722CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233722C related cluster n=1 Tax=unknown RepID=UPI000233722C SoyBaseE_val: 3.00E-24ISS

Expression Patterns of Glyma02g30052
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g30052 not represented in the dataset
Glyma02g30052 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g30052 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g176400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g30052
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g30052
>Glyma02g30052.1   sequence type=CDS   gene model=Glyma02g30052   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGACGGTGAATCTGGGAATGCTTCATTACTTACTGGACCACATATACGGCGCGTTGATGCACCGCAGCAGGATAAGCACGCCGTTCTTTTCTCGCGGGTGGGGCGGCACGAAGCTAGAGATGCTGGAGAAGATGATTGGGCCGCTTTGGTGCGGCCCATTTGGAGAACCGTCTGGGAGACCGGAACGGCTTCCTTGA
Predicted protein sequences of Glyma02g30052
>Glyma02g30052.1   sequence type=predicted peptide   gene model=Glyma02g30052   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTVNLGMLHYLLDHIYGALMHRSRISTPFFSRGWGGTKLEMLEKMIGPLWCGPFGEPSGRPERLP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo