Glyma02g29260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g29260

Feature Type:	gene_model
Chromosome:	Gm02
Start:	30776818
stop:	30784702
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g29260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G42130	AT	Annotation by Michelle Graham. TAIR10: Plastid-lipid associated protein PAP / fibrillin family protein \| chr2:17566242-17567916 FORWARD LENGTH=299	SoyBase	E_val: 2.00E-138	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0005198	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural molecule activity	SoyBase	N/A	ISS
PF04755	PFAM	PAP fibrillin	JGI		ISS
UniRef100_H2DL86	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plastid lipid-associated protein n=1 Tax=Vitis pseudoreticulata RepID=H2DL86_9ROSI	SoyBase	E_val: 1.00E-139	ISS
UniRef100_I1JG19	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JG19_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma02g29260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g29260

Paralog	Evidence	Comments
Glyma09g17130	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g29260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g173600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g29260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g29260

Limit To All Plant Sequences

>Glyma02g29260.1   sequence type=CDS   gene model=Glyma02g29260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAATCGCTGCTTCAGCTTCTTCACATGCTTGTATTTCCTCAATCCCCACATGCATCCCCTCTTCCTCTTCCAAATTCTCTTCTTCGCTGACACTTTCTTCACTCCAAAGAGGCTCAAATAAGAGATCGGGATGCAGAGCCATGGTTCAACAAGCCGTTCAGGGTGCCCCTGCTGCGTATGCCAAAGAAATGGAACGCCTTTCTGCCAAAGAATCGCTTCTTCTTGCTTTTAAAGATGCAGGGGGTTTTGAGGCCTTGGTCTCCGGGAAGACTACGGAATGGCAAAAGATTGATGTGAATGAAAGGATAACTGGTCTTGAGAGGCTCAATCCAACACCTCGCCCCACAACGTCACCCTTCTTGGAGGGGCAATGGAACTTTGAGTGGTTTGGTTCTGGAAGTCCAGGCTTGTTTGCTGCTAGGTTTATATTTGAAATCTTTCCTTCAACTTTGGCTAATTTGTCAAAAATGGATGTCGTTATTAAAGATGGAAATGCGAAGATTACTGCAAATATGAGATTATTAAACTCGATAGAAAACAAAGTCATTCTCTCAACCAAATTATCTGTGGAGGGGCCACTTAGAATGAAAGAAGAGTATGTTGAAGGGGTTCTTGTGACACCAACAATTATTGAAGAGAGAGTACCAGAACAACTTAAAGGTGCACTGGGGCAGGCAGCTAATGCTTTACAACAACTTCCTACCCCTATATGGGATCCTGTTGCCAGTGGGCTGAAAGTTCCTCTAAGTGGGAGCTTTCAAAGACTCTTCATGATTTCTTATCTCGATGAGGAGATACTTATAATAAGGAACACAGCCGGGATTCCAGAAGTTTTAACGAGGTTGGATGCAGCACCATCTTCCTTGGGAGATTCAAGTCCAGAGTATGAAAGCTAG

Predicted protein sequences of Glyma02g29260

Limit To All Plant Sequences

>Glyma02g29260.1   sequence type=predicted peptide   gene model=Glyma02g29260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSIAASASSHACISSIPTCIPSSSSKFSSSLTLSSLQRGSNKRSGCRAMVQQAVQGAPAAYAKEMERLSAKESLLLAFKDAGGFEALVSGKTTEWQKIDVNERITGLERLNPTPRPTTSPFLEGQWNFEWFGSGSPGLFAARFIFEIFPSTLANLSKMDVVIKDGNAKITANMRLLNSIENKVILSTKLSVEGPLRMKEEYVEGVLVTPTIIEERVPEQLKGALGQAANALQQLPTPIWDPVASGLKVPLSGSFQRLFMISYLDEEILIIRNTAGIPEVLTRLDAAPSSLGDSSPEYES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain