Glyma02g28927 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g28927): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g28927): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g28927

Feature Type:	gene_model
Chromosome:	Gm02
Start:	30269518
stop:	30270692
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g28927

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G34630	AT	Annotation by Michelle Graham. TAIR10: geranyl diphosphate synthase 1 \| chr2:14579726-14581632 FORWARD LENGTH=321	SoyBase	E_val: 2.00E-49	ISS
GO:0006744	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process	SoyBase	N/A	ISS
GO:0008299	GO-bp	Annotation by Michelle Graham. GO Biological Process: isoprenoid biosynthetic process	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0004161	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dimethylallyltranstransferase activity	SoyBase	N/A	ISS
GO:0004659	GO-mf	Annotation by Michelle Graham. GO Molecular Function: prenyltransferase activity	SoyBase	N/A	ISS
GO:0050347	GO-mf	Annotation by Michelle Graham. GO Molecular Function: trans-octaprenyltranstransferase activity	SoyBase	N/A	ISS
PTHR12001	Panther	GERANYLGERANYL PYROPHOSPHATE SYNTHASE	JGI		ISS
PTHR12001:SF19	Panther	gb def: putative isopentenyl pyrophosphate isomerase, fps [halobacterium sp. nrc-1]	JGI		ISS
PF00348	PFAM	Polyprenyl synthetase	JGI		ISS
UniRef100_B9SVW8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Geranylgeranyl pyrophosphate synthase, putative n=1 Tax=Ricinus communis RepID=B9SVW8_RICCO	SoyBase	E_val: 6.00E-50	ISS
UniRef100_UPI0002336BB9	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002336BB9 related cluster n=1 Tax=unknown RepID=UPI0002336BB9	SoyBase	E_val: 6.00E-71	ISS

Expression Patterns of Glyma02g28927

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g28927 not represented in the dataset	Glyma02g28927 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g28927 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g171800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g28927

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g28927

Limit To All Plant Sequences

>Glyma02g28927.1   sequence type=CDS   gene model=Glyma02g28927   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTCAAAGGTGGCAAGCCTTATTCATGATGATGTATTGGATGATGCAGATACCAGACGTGGTATTGGTTTGTTGAATTTTTTAATGGACGATATGGTTGTATCTTCAATTGCAAAAGTTGTAGAGCATCTTGTAACTGGGGAGACCATCATGGAATATTATATGCAAAAGACCTACTACAAGACTGCACCTTTAATGTCAAATAGTTGCAAGGCAATGCCCATCCTTGCAGGCCCAACAACAGACGTTGCAATGCTTGCTTTTGAGTATGGAAAAAATCTGGGTTTGGCATTTCAGTTGATAGGTGATGTGCTTGATTTCACAGGCACATCATCTTCCCTTGGAAAGGGTTCTTGTACACATGACTAG

Predicted protein sequences of Glyma02g28927

Limit To All Plant Sequences

>Glyma02g28927.1   sequence type=predicted peptide   gene model=Glyma02g28927   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSKVASLIHDDVLDDADTRRGIGLLNFLMDDMVVSSIAKVVEHLVTGETIMEYYMQKTYYKTAPLMSNSCKAMPILAGPTTDVAMLAFEYGKNLGLAFQLIGDVLDFTGTSSSLGKGSCTHD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain