SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g28927

Feature Type:gene_model
Chromosome:Gm02
Start:30269518
stop:30270692
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g28927
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34630AT Annotation by Michelle Graham. TAIR10: geranyl diphosphate synthase 1 | chr2:14579726-14581632 FORWARD LENGTH=321 SoyBaseE_val: 2.00E-49ISS
GO:0006744GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process SoyBaseN/AISS
GO:0008299GO-bp Annotation by Michelle Graham. GO Biological Process: isoprenoid biosynthetic process SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0004161GO-mf Annotation by Michelle Graham. GO Molecular Function: dimethylallyltranstransferase activity SoyBaseN/AISS
GO:0004659GO-mf Annotation by Michelle Graham. GO Molecular Function: prenyltransferase activity SoyBaseN/AISS
GO:0050347GO-mf Annotation by Michelle Graham. GO Molecular Function: trans-octaprenyltranstransferase activity SoyBaseN/AISS
PTHR12001Panther GERANYLGERANYL PYROPHOSPHATE SYNTHASE JGI ISS
PTHR12001:SF19Panther gb def: putative isopentenyl pyrophosphate isomerase, fps [halobacterium sp. nrc-1] JGI ISS
PF00348PFAM Polyprenyl synthetase JGI ISS
UniRef100_B9SVW8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Geranylgeranyl pyrophosphate synthase, putative n=1 Tax=Ricinus communis RepID=B9SVW8_RICCO SoyBaseE_val: 6.00E-50ISS
UniRef100_UPI0002336BB9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336BB9 related cluster n=1 Tax=unknown RepID=UPI0002336BB9 SoyBaseE_val: 6.00E-71ISS

Expression Patterns of Glyma02g28927
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g28927 not represented in the dataset
Glyma02g28927 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g28927 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g171800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g28927
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g28927
>Glyma02g28927.1   sequence type=CDS   gene model=Glyma02g28927   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTCAAAGGTGGCAAGCCTTATTCATGATGATGTATTGGATGATGCAGATACCAGACGTGGTATTGGTTTGTTGAATTTTTTAATGGACGATATGGTTGTATCTTCAATTGCAAAAGTTGTAGAGCATCTTGTAACTGGGGAGACCATCATGGAATATTATATGCAAAAGACCTACTACAAGACTGCACCTTTAATGTCAAATAGTTGCAAGGCAATGCCCATCCTTGCAGGCCCAACAACAGACGTTGCAATGCTTGCTTTTGAGTATGGAAAAAATCTGGGTTTGGCATTTCAGTTGATAGGTGATGTGCTTGATTTCACAGGCACATCATCTTCCCTTGGAAAGGGTTCTTGTACACATGACTAG
Predicted protein sequences of Glyma02g28927
>Glyma02g28927.1   sequence type=predicted peptide   gene model=Glyma02g28927   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSKVASLIHDDVLDDADTRRGIGLLNFLMDDMVVSSIAKVVEHLVTGETIMEYYMQKTYYKTAPLMSNSCKAMPILAGPTTDVAMLAFEYGKNLGLAFQLIGDVLDFTGTSSSLGKGSCTHD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo