|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G52990 | AT | Annotation by Michelle Graham. TAIR10: Pyruvate kinase family protein | chr3:19649046-19652237 FORWARD LENGTH=527 | SoyBase | E_val: 3.00E-74 | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0000287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004743 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: pyruvate kinase activity | SoyBase | N/A | ISS |
| GO:0030955 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: potassium ion binding | SoyBase | N/A | ISS |
| PTHR11817 | Panther | PYRUVATE KINASE | JGI | ISS | |
| PF00224 | PFAM | Pyruvate kinase, barrel domain | JGI | ISS | |
| UniRef100_I1NHP8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pyruvate kinase n=1 Tax=Glycine max RepID=I1NHP8_SOYBN | SoyBase | E_val: 3.00E-87 | ISS |
| UniRef100_UPI0002336BB5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002336BB5 related cluster n=1 Tax=unknown RepID=UPI0002336BB5 | SoyBase | E_val: 5.00E-100 | ISS |
|
Glyma02g28212 not represented in the dataset |
Glyma02g28212 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g165300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g28212.1 sequence type=CDS gene model=Glyma02g28212 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAGTCGAGTCCTTTGCTTCTGGAGGAACCCATAAGGATGGCCTCCATCCTCGAGCCATCCAAGCCTAGTTTCTTTCCAGCGATGACAAAGATTGTTGGCACACTTGGCCCAAAGTCACGATCGGTTGACGTGATTTCCCAATGTCTTGAGGCAGGAATGTCTGTGGCAAGGTTTGATTTTTCATGGGGTGATCCTGAATACCACCAAGAGACGTTGGAAAATTTAAGGGCTGCTATCAAAAGTACCAAGAAACTTTGTGCGGTTATGCTAGATACCGTGGGTCCAGAACTACAAGTTGTCAACAAAACTGAGCACCCAATTTCCCTTCAGGCTGACACATTGGTTGTCTTAACTCCTGATCAGAACAAAGAAGCTACTTCAAATCTTTTACCTGTAAATTTTAGTGGACTTTCAAAGGTCAGTAATGGT
>Glyma02g28212.1 sequence type=predicted peptide gene model=Glyma02g28212 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQSSPLLLEEPIRMASILEPSKPSFFPAMTKIVGTLGPKSRSVDVISQCLEAGMSVARFDFSWGDPEYHQETLENLRAAIKSTKKLCAVMLDTVGPELQVVNKTEHPISLQADTLVVLTPDQNKEATSNLLPVNFSGLSKVSNG
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||