SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g27110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g27110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g27110

Feature Type:gene_model
Chromosome:Gm02
Start:28271123
stop:28271414
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g27110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G02960AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S12/S23 family protein | chr5:693280-694396 REVERSE LENGTH=142 SoyBaseE_val: 3.00E-22ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR11652Panther 30S RIBOSOMAL PROTEIN S12 FAMILY MEMBER JGI ISS
PF00164PFAM Ribosomal protein S12 JGI ISS
UniRef100_E4XCG7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_21 n=1 Tax=Oikopleura dioica RepID=E4XCG7_OIKDI SoyBaseE_val: 2.00E-20ISS
UniRef100_UPI000233E44EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E44E related cluster n=1 Tax=unknown RepID=UPI000233E44E SoyBaseE_val: 2.00E-23ISS

Expression Patterns of Glyma02g27110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g27110 not represented in the dataset
Glyma02g27110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g27110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g27110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g27110
>Glyma02g27110.1   sequence type=CDS   gene model=Glyma02g27110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGTAAGCATCCCAACTCTGCCATTCATAAGTGTGTCAGGGTTCAACTTATCAAGAATTGGAAGAAGATTGTCGCTTTTGTCCCTAATGATGGTTGCTTGAACTACATTGAAGAGAATGACGAAGTCTTGATTATTGTTTTCAATAGTTTCTCTCAAGTATTATGA
Predicted protein sequences of Glyma02g27110
>Glyma02g27110.1   sequence type=predicted peptide   gene model=Glyma02g27110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CKHPNSAIHKCVRVQLIKNWKKIVAFVPNDGCLNYIEENDEVLIIVFNSFSQVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo