SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g27000

Feature Type:gene_model
Chromosome:Gm02
Start:28167796
stop:28169238
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G39200AT Annotation by Michelle Graham. TAIR10: Seven transmembrane MLO family protein | chr2:16356255-16359797 REVERSE LENGTH=576 SoyBaseE_val: 5.00E-19ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0008219GO-bp Annotation by Michelle Graham. GO Biological Process: cell death SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
PF03094PFAM Mlo family JGI ISS
UniRef100_I1MNL9UniRef Annotation by Michelle Graham. Most informative UniRef hit: MLO-like protein n=1 Tax=Glycine max RepID=I1MNL9_SOYBN SoyBaseE_val: 1.00E-20ISS
UniRef100_UPI00023373A3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023373A3 related cluster n=1 Tax=unknown RepID=UPI00023373A3 SoyBaseE_val: 5.00E-40ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g27000.1   sequence type=CDS   gene model=Glyma02g27000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTGGCATCTCCAATCTTCTTTCTTCCTTCTCTATTTCCTTGCCATTAATCTTCAAGAAGCAAAGGACTTCATTGATGAAGAAGATCCAAGGCCTACAAGCTCAACATGGAGCTACATCACTACTCATTCTGCAATCTTATTAGTGGGTGTCAAGCTACAAAGGATCATAACAAAGATGGGACTAAGGATTGAAGACAAAGGGGAAGTATTCAAGGATGCACTAGTGGTGGAGCCAGGAGATGACTTGTTCTGGTTCAACTGTCCACGCCTCCTTCTCTTTGTCATTCATCTTGTTTTCTTTCTTGGCACTAAAATTGGAATTTATGGATCTAATTGCCCAGAATGGATTATGGCAATGGAGATGCATGCCAAAGATATGATCCTAACCAAAGCCAATCTTCGGTCTTTGTTTATTTTACATCTCTTAGTAAACAGATATGAGGAAGAGAAAGCTAAAGCCACCGCAATTGGAATTAAGCCATATTCGTGGCATGACTTCTTGCACTTGGTT

>Glyma02g27000.1   sequence type=predicted peptide   gene model=Glyma02g27000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVWHLQSSFFLLYFLAINLQEAKDFIDEEDPRPTSSTWSYITTHSAILLVGVKLQRIITKMGLRIEDKGEVFKDALVVEPGDDLFWFNCPRLLLFVIHLVFFLGTKIGIYGSNCPEWIMAMEMHAKDMILTKANLRSLFILHLLVNRYEEEKAKATAIGIKPYSWHDFLHLV







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo