Report for Sequence Feature Glyma02g26850
Feature Type: gene_model
Chromosome: Gm02
Start: 27960723
stop: 27964591
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g26850
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G58470 AT
Annotation by Michelle Graham. TAIR10: nucleic acid binding;methyltransferases | chr3:21627070-21628507 REVERSE LENGTH=248
SoyBase E_val: 6.00E-98 ISS
GO:0032259 GO-bp
Annotation by Michelle Graham. GO Biological Process: methylation
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0003676 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding
SoyBase N/A ISS
GO:0008168 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity
SoyBase N/A ISS
KOG3350
KOG
Uncharacterized conserved protein
JGI ISS
PTHR13200 Panther
UNCHARACTERIZED
JGI ISS
PF10237 PFAM
Probable N6-adenine methyltransferase
JGI ISS
UniRef100_I1JFW8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1JFW8_SOYBN
SoyBase E_val: 7.00E-172 ISS
UniRef100_Q93Z55 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT3g58470/F14P22_60 n=1 Tax=Arabidopsis thaliana RepID=Q93Z55_ARATH
SoyBase E_val: 3.00E-95 ISS
Expression Patterns of Glyma02g26850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma02g26850
Paralog Evidence Comments
Glyma09g15650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g26850 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g167800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g26850
Coding sequences of Glyma02g26850
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g26850.1 sequence type=CDS gene model=Glyma02g26850 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAACCAACTCGAACTGAACCCTAACTCGCTGACCGAACTCAGTGAGTCCTCGGCGCCGTCCGACGACGACGAACCGGCTCTGAGCTCCCACACCCTCGCCGCCCTCAAAGAATTCCTCGCCGAGCAGCAACGCGGCTCCGACGCCGGCGGAGAGTCCGAGGTTTCTCTGGTGTCTGAGGATTGGAGGCTGAGCCAGTTCTGGTACAGCCCCGAAACCGCCACAACCGTCGCCGAAGAAGTTCTCGCTCTCTGCGGCGGCGGCATCCGCGCTCGCGTCGCCTGCATCGCTTGCCCTACCCTCTATGCTTATCTCAAGAAAATGGATCCTAATGTGCCTGCGCAACTTCTGGAGTATGACAAACGTTTTGGGCAATATGGAAGTGAGTACACATTTTATGACTACAATCACCCTGAGGATATTCCATCAGAATTGAAGCATTCCTGCAAAGTTGTAGTTGCTGATCCTCCTTACTTGAGCAAAGAGTGCTTGGAGAAAGTGGCTGAAACAATTCATCTGCTCGTACAACCTGGAGAGTCATTTTTGCTTCTACTCACAGGTGAAGTGCAGAAAGAAAGAGCAGCAGAGATCTTGGGCTTGCATCCTTGTGGTTTTAGGCCCCAGCACTCCAGCAAACTTGGAAATGAGTTTCGGCTGTTCTCAAACTATGACCCTGGAACGAGACTAGGAGGGTGGGAAAAATAG
Predicted protein sequences of Glyma02g26850
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g26850.1 sequence type=predicted peptide gene model=Glyma02g26850 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MENQLELNPNSLTELSESSAPSDDDEPALSSHTLAALKEFLAEQQRGSDAGGESEVSLVSEDWRLSQFWYSPETATTVAEEVLALCGGGIRARVACIACPTLYAYLKKMDPNVPAQLLEYDKRFGQYGSEYTFYDYNHPEDIPSELKHSCKVVVADPPYLSKECLEKVAETIHLLVQPGESFLLLLTGEVQKERAAEILGLHPCGFRPQHSSKLGNEFRLFSNYDPGTRLGGWEK*