SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g26850

Feature Type:gene_model
Chromosome:Gm02
Start:27960723
stop:27964591
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G58470AT Annotation by Michelle Graham. TAIR10: nucleic acid binding;methyltransferases | chr3:21627070-21628507 REVERSE LENGTH=248 SoyBaseE_val: 6.00E-98ISS
GO:0032259GO-bp Annotation by Michelle Graham. GO Biological Process: methylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
KOG3350 KOG Uncharacterized conserved protein JGI ISS
PTHR13200Panther UNCHARACTERIZED JGI ISS
PF10237PFAM Probable N6-adenine methyltransferase JGI ISS
UniRef100_I1JFW8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1JFW8_SOYBN SoyBaseE_val: 7.00E-172ISS
UniRef100_Q93Z55UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g58470/F14P22_60 n=1 Tax=Arabidopsis thaliana RepID=Q93Z55_ARATH SoyBaseE_val: 3.00E-95ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g15650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g167800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g26850.1   sequence type=CDS   gene model=Glyma02g26850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAACCAACTCGAACTGAACCCTAACTCGCTGACCGAACTCAGTGAGTCCTCGGCGCCGTCCGACGACGACGAACCGGCTCTGAGCTCCCACACCCTCGCCGCCCTCAAAGAATTCCTCGCCGAGCAGCAACGCGGCTCCGACGCCGGCGGAGAGTCCGAGGTTTCTCTGGTGTCTGAGGATTGGAGGCTGAGCCAGTTCTGGTACAGCCCCGAAACCGCCACAACCGTCGCCGAAGAAGTTCTCGCTCTCTGCGGCGGCGGCATCCGCGCTCGCGTCGCCTGCATCGCTTGCCCTACCCTCTATGCTTATCTCAAGAAAATGGATCCTAATGTGCCTGCGCAACTTCTGGAGTATGACAAACGTTTTGGGCAATATGGAAGTGAGTACACATTTTATGACTACAATCACCCTGAGGATATTCCATCAGAATTGAAGCATTCCTGCAAAGTTGTAGTTGCTGATCCTCCTTACTTGAGCAAAGAGTGCTTGGAGAAAGTGGCTGAAACAATTCATCTGCTCGTACAACCTGGAGAGTCATTTTTGCTTCTACTCACAGGTGAAGTGCAGAAAGAAAGAGCAGCAGAGATCTTGGGCTTGCATCCTTGTGGTTTTAGGCCCCAGCACTCCAGCAAACTTGGAAATGAGTTTCGGCTGTTCTCAAACTATGACCCTGGAACGAGACTAGGAGGGTGGGAAAAATAG

>Glyma02g26850.1   sequence type=predicted peptide   gene model=Glyma02g26850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENQLELNPNSLTELSESSAPSDDDEPALSSHTLAALKEFLAEQQRGSDAGGESEVSLVSEDWRLSQFWYSPETATTVAEEVLALCGGGIRARVACIACPTLYAYLKKMDPNVPAQLLEYDKRFGQYGSEYTFYDYNHPEDIPSELKHSCKVVVADPPYLSKECLEKVAETIHLLVQPGESFLLLLTGEVQKERAAEILGLHPCGFRPQHSSKLGNEFRLFSNYDPGTRLGGWEK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo