SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g26643

Feature Type:gene_model
Chromosome:Gm02
Start:27640882
stop:27641519
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g26643
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24960AT Annotation by Michelle Graham. TAIR10: HVA22 homologue D | chr4:12828401-12828982 FORWARD LENGTH=104 SoyBaseE_val: 2.00E-15ISS
GO:0009269GO-bp Annotation by Michelle Graham. GO Biological Process: response to desiccation SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010507GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of autophagy SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12300Panther HVA22-LIKE PROTEINS JGI ISS
PTHR12300:SF11Panther HVA22-LIKE PROTEIN JGI ISS
PF03134PFAM TB2/DP1, HVA22 family JGI ISS
UniRef100_G7J3D8UniRef Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein e n=1 Tax=Medicago truncatula RepID=G7J3D8_MEDTR SoyBaseE_val: 7.00E-22ISS
UniRef100_I1KC07UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KC07_SOYBN SoyBaseE_val: 1.00E-41ISS

Expression Patterns of Glyma02g26643
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g26643 not represented in the dataset
Glyma02g26643 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g26643 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g169300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g26643
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g26643
>Glyma02g26643.1   sequence type=CDS   gene model=Glyma02g26643   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCTTCAACCTATCTTAGAGTGGATACCAATTTGGTACAATGTGAAGCTATTGACAGTGGCATGGCTGGTGTTGCCACAGTTCGCAGGAGCTGCGTACTTATATGAAAGGTTTAGACAACATCTCTATGACAACCACCAGCAACAAAGAAAAAAGTCTCCCAATAACGGTGGCAAGGCCAAGAAGTTCTTCGAATTCGTCACGCCCAAGAAAAGGGATCAAGAGGCGTATTGA
Predicted protein sequences of Glyma02g26643
>Glyma02g26643.1   sequence type=predicted peptide   gene model=Glyma02g26643   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILQPILEWIPIWYNVKLLTVAWLVLPQFAGAAYLYERFRQHLYDNHQQQRKKSPNNGGKAKKFFEFVTPKKRDQEAY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo