|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G48320 | AT | Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr1:17855024-17855577 REVERSE LENGTH=156 | SoyBase | E_val: 1.00E-36 | ISS |
| GO:0042372 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process | SoyBase | N/A | ISS |
| GO:0005777 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: peroxisome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016788 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds | SoyBase | N/A | ISS |
| GO:0047617 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity | SoyBase | N/A | ISS |
| PTHR12418 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR12418:SF10 | Panther | JGI | ISS | ||
| PF03061 | PFAM | Thioesterase superfamily | JGI | ISS | |
| UniRef100_C6T4X8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4X8_SOYBN | SoyBase | E_val: 3.00E-44 | ISS |
| UniRef100_G7IQD8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Esterase ydiI n=1 Tax=Medicago truncatula RepID=G7IQD8_MEDTR | SoyBase | E_val: 3.00E-37 | ISS |
|
Glyma02g26521 not represented in the dataset |
Glyma02g26521 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g170200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g26521.1 sequence type=CDS gene model=Glyma02g26521 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTTCAACACTTATCTTCACAAAGGGTGTCTGGACATCTCACTGTCACCCAAAAGTGCTGCCAGCCATTTAAGGTGTTGCATGGAGGGGTATCAGCACTGATTGCAGAATCTTTGGCAAGCATGGGAGCCCACATGGCTAGTGGATACCAAAGAGTGGCTGGGATTCAACTCAGCATCAACCATTTGAAAAGTGTTGTGCTTTGTTACTTGCTCTATGCTGAAGCTATCCCTTTAAATGTTGGCAGATCCATTCGGTTTGATAGGTATATATATTTATTGAATGAAGTTTGCCTTTTAAACTTGGCTCCGTCTAGGGGTGGGAATAGGTCAGGCCAGGCTTTAAAAGGCCTGAGCCTAGCCTACGATTAA
>Glyma02g26521.1 sequence type=predicted peptide gene model=Glyma02g26521 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LQHLSSQRVSGHLTVTQKCCQPFKVLHGGVSALIAESLASMGAHMASGYQRVAGIQLSINHLKSVVLCYLLYAEAIPLNVGRSIRFDRYIYLLNEVCLLNLAPSRGGNRSGQALKGLSLAYD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||