SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g26521

Feature Type:gene_model
Chromosome:Gm02
Start:27430912
stop:27432128
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g26521
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48320AT Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr1:17855024-17855577 REVERSE LENGTH=156 SoyBaseE_val: 1.00E-36ISS
GO:0042372GO-bp Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0047617GO-mf Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity SoyBaseN/AISS
PTHR12418Panther FAMILY NOT NAMED JGI ISS
PTHR12418:SF10Panther JGI ISS
PF03061PFAM Thioesterase superfamily JGI ISS
UniRef100_C6T4X8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4X8_SOYBN SoyBaseE_val: 3.00E-44ISS
UniRef100_G7IQD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Esterase ydiI n=1 Tax=Medicago truncatula RepID=G7IQD8_MEDTR SoyBaseE_val: 3.00E-37ISS

Expression Patterns of Glyma02g26521
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g26521 not represented in the dataset
Glyma02g26521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g26521 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g170200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g26521
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g26521
>Glyma02g26521.1   sequence type=CDS   gene model=Glyma02g26521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTCAACACTTATCTTCACAAAGGGTGTCTGGACATCTCACTGTCACCCAAAAGTGCTGCCAGCCATTTAAGGTGTTGCATGGAGGGGTATCAGCACTGATTGCAGAATCTTTGGCAAGCATGGGAGCCCACATGGCTAGTGGATACCAAAGAGTGGCTGGGATTCAACTCAGCATCAACCATTTGAAAAGTGTTGTGCTTTGTTACTTGCTCTATGCTGAAGCTATCCCTTTAAATGTTGGCAGATCCATTCGGTTTGATAGGTATATATATTTATTGAATGAAGTTTGCCTTTTAAACTTGGCTCCGTCTAGGGGTGGGAATAGGTCAGGCCAGGCTTTAAAAGGCCTGAGCCTAGCCTACGATTAA
Predicted protein sequences of Glyma02g26521
>Glyma02g26521.1   sequence type=predicted peptide   gene model=Glyma02g26521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LQHLSSQRVSGHLTVTQKCCQPFKVLHGGVSALIAESLASMGAHMASGYQRVAGIQLSINHLKSVVLCYLLYAEAIPLNVGRSIRFDRYIYLLNEVCLLNLAPSRGGNRSGQALKGLSLAYD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo